You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
LILRA1
Leukocyte immunoglobulin-like receptor subfamily A member 1

Protein Classes
Protein Summary
Description
May act as receptor for class I MHC antigens. This gene encodes an activating member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein is predominantly expressed in B cells, interacts with major histocompatibility complex class I ligands, and contributes to the regulation of immune responses. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000251372
  • ENSP00000251372
  • ENSG00000104974
  • ENST00000453777
  • ENSP00000413715
  • ENST00000617170
  • ENSP00000477637
  • ENSG00000275525
  • ENST00000620606
  • ENSP00000478666
  • ENST00000628480
  • ENSP00000487229
  • ENSG00000277398
  • ENST00000631007
  • ENSP00000487011
  • ENSG00000274935

Symbol
  • LIR6
  • LIR6
  • CD85I
  • LIR-6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
1
tissue sample
0.73
cell line
0.65
cell type or tissue
0.62
protein domain
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.32   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 175   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.32   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 175   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Immune System
Reactome
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Immune System
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Protein-Protein Interactions (135)
1 – 10 of 135
LILRA3
Tdark
p_int: 0.999999325
p_ni: 1e-9
p_wrong: 6.75e-7
Data Source: BioPlex
HLA-G
Tbio
Novelty: 0.00082058
Score: 0.937
Data Source: STRINGDB
HLA-F
Tbio
Novelty: 0.01349191
Score: 0.937
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.935
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.935
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.935
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.935
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.935
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.935
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.935
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.32

PubMed score by year
PubTator Score  4.55

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTPIVTVLICLRLSLGPRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWI
1-70
TRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGN
70-140
VTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSL
140-210
PSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQA
210-280
NFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWG
280-350
PFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVS
350-420
GAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVENLIRMGIAGLVLVVLGILLFEAQHSQRSL
420-489
MTPIVTVLICLRLSLGPRTHVQAGTLPKPTLWAEPGSVITQGSPVTLWCQGILETQEYRLYREKKTAPWITRIPQEIVKKGQFPIPSITWEHTGRYRCFYGSHTAGWSEPSDPLELVVTGAYIKPTLSALPSPVVTSGGNVTLHCVSQVAFGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAYDSNSPHVWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPGESLTLQCVSDVSYDRFVLYKEGERDFLQLPGPQPQAGLSQANFTLGPVSRSYGGQYRCSGAYNLSSEWSAPSDPLDILIAGQFRGRPFISVHPGPTVASGENVTLLCQSWGPFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHSGTYRCYGSLSSNPYLLSHPSDSLELMVSGAAETLSPPQNKSDSKAGAANTLSPSQNKTASHPQDYTVENLIRMGIAGLVLVVLGILLFEAQHSQRSL