You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CUTA
Protein CutA

Protein Summary
Description
May form part of a complex of membrane proteins attached to acetylcholinesterase (AChE).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000374496
  • ENSP00000363620
  • ENSG00000112514
  • ENST00000374500
  • ENSP00000363624
  • ENST00000435267
  • ENSP00000391509
  • ENSG00000226492
  • ENST00000440279
  • ENSP00000403268
  • ENST00000440930
  • ENSP00000400114
  • ENST00000487148
  • ENSP00000432744
  • ENST00000488034
  • ENSP00000417544
  • ENST00000607266
  • ENSP00000475963
  • ENST00000611509
  • ENSP00000480360

Symbol
  • ACHAP
  • C6orf82
  • ACHAP
  • C6orf82
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.99
disease perturbation
0.9
transcription factor binding site profile
0.84
transcription factor perturbation
0.8
transcription factor
0.77


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 46.58   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 164   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 46.58   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 164   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (6)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (46)
1 – 10 of 46
UPP1
Tchem
Family: Enzyme
Novelty: 0.01749136
p_int: 0.999999993
p_ni: 7e-9
p_wrong: 1e-9
Score: 0.297
Data Source: BioPlex,STRINGDB
PRKAA1
Tclin
Family: Kinase
Novelty: 0.01012358
p_int: 0.998614332
p_ni: 0.001385668
Score: 0.696
Data Source: BioPlex,STRINGDB
FBLIM1
Tbio
Novelty: 0.04280121
p_int: 0.998036292
p_ni: 0.001963708
Score: 0.252
Data Source: BioPlex,STRINGDB
CLTCL1
Tbio
Novelty: 0.05165674
p_int: 0.997784224
p_ni: 0.002215776
Data Source: BioPlex
UBB
Tbio
Novelty: 0.00895161
p_int: 0.995864567
p_ni: 0.004135433
Score: 0.172
Data Source: BioPlex,STRINGDB
PRKAB1
Tchem
Family: Kinase
Novelty: 0.027886
p_int: 0.991844952
p_ni: 0.008153308
p_wrong: 0.000001739
Score: 0.56
Data Source: BioPlex,STRINGDB
GID4
Tbio
Novelty: 0.10469899
p_int: 0.981481436
p_ni: 0.018518564
Data Source: BioPlex
ARMC8
Tbio
Novelty: 0.08450354
p_int: 0.978821154
p_ni: 0.021178846
Data Source: BioPlex
ZER1
Tbio
Novelty: 0.05686147
p_int: 0.976720146
p_ni: 0.023279854
Score: 0.173
Data Source: BioPlex,STRINGDB
PRKAG1
Tbio
Family: Kinase
Novelty: 0.1139086
p_int: 0.953873813
p_ni: 0.046126187
Score: 0.765
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  46.58

PubMed score by year
PubTator Score  11.82

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSGGRAPAVLLGGVASLLLSFVWMPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSA
1-70
AFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSV
70-140
HPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP
140-179
MSGGRAPAVLLGGVASLLLSFVWMPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP