You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DKC1
H/ACA ribonucleoprotein complex subunit DKC1

Protein Summary
Description
Isoform 1: Catalytic subunit of H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA (PubMed:25219674). This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1 (PubMed:25219674). Each rRNA can contain up to 100 pseudouridine ('psi') residues, which may serve to stabilize the conformation of rRNAs. Required for ribosome biogenesis and telomere maintenance (PubMed:19179534, PubMed:25219674). Also required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme (PubMed:19179534). Isoform 3: Promotes cell to cell and cell to substratum adhesion, increases the cell proliferation rate and leads to cytokeratin hyper-expression. This gene functions in two distinct complexes. It plays an active role in telomerase stabilization and maintenance, as well as recognition of snoRNAs containing H/ACA sequen ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369550
  • ENSP00000358563
  • ENSG00000130826
  • ENST00000620277
  • ENSP00000478387

Symbol
  • NOLA4
  • DKC
  • CBF5
  • DKCX
  • NAP57
  • NOLA4
  • XAP101
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
hub protein
1
drug perturbation
0.99
interacting protein
0.99
protein complex
0.99
co-expressed gene
0.98


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 276.31   (req: < 5)
Gene RIFs: 58   (req: <= 3)
Antibodies: 380   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 276.31   (req: >= 5)
Gene RIFs: 58   (req: > 3)
Antibodies: 380   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 22
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (12)
Cell Cycle (R-HSA-1640170)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell Cycle
Reactome
Chromosome Maintenance
Reactome
Extension of Telomeres
Reactome
Metabolism of RNA
Reactome
Telomere Extension By Telomerase
Name
Explore in Pharos
Explore in Source
Cell Cycle
Chromosome Maintenance
Extension of Telomeres
Metabolism of RNA
Telomere Extension By Telomerase
Protein-Protein Interactions (416)
1 – 10 of 416
SHQ1
Tbio
Novelty: 0.0779191
p_int: 0.999999921
p_ni: 7.3e-8
p_wrong: 6e-9
Score: 0.996
Data Source: BioPlex,STRINGDB
NAF1
Tbio
p_int: 0.999996789
p_ni: 0.000003211
Score: 0.992
Data Source: BioPlex,STRINGDB
GAR1
Tbio
Novelty: 0.47908745
p_int: 0.999949871
p_ni: 0.000050129
Score: 0.999
Data Source: BioPlex,STRINGDB
BCHE
Tclin
Family: Enzyme
Novelty: 0.00041933
p_int: 0.998889176
p_ni: 0.001110824
Data Source: BioPlex
NOP10
Tbio
Novelty: 0.04109748
p_int: 0.998206971
p_ni: 0.001792924
p_wrong: 1.05e-7
Score: 0.999
Data Source: BioPlex,STRINGDB
ZCRB1
Tdark
Novelty: 0.37037037
p_int: 0.99149133
p_ni: 0.00850867
Score: 0.428
Data Source: BioPlex,STRINGDB
WRAP53
Tbio
Family: Enzyme
Novelty: 0.02564456
p_int: 0.983813546
p_ni: 0.016186453
p_wrong: 1e-9
Score: 0.993
Data Source: BioPlex,STRINGDB
ZC3HAV1
Tbio
Novelty: 0.01794897
p_int: 0.979459834
p_ni: 0.020540166
Score: 0.473
Data Source: BioPlex,STRINGDB
RPL14
Tbio
Novelty: 0.02076783
p_int: 0.972947243
p_ni: 0.027052757
Score: 0.371
Data Source: BioPlex,STRINGDB
HIST1H1T
Tdark
Novelty: 0.01211318
p_int: 0.971067103
p_ni: 0.028932897
Score: 0.177
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  276.31

PubMed score by year
PubTator Score  154.62

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MADAEVIILPKKHKKKKERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYT
1-70
PLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTLDPKVTGCLIVCIERAT
70-140
RLVKSQQSAGKEYVGIVRLHNAIEGGTQLSRALETLTGALFQRPPLIAAVKRQLRVRTIYESKMIEYDPE
140-210
RRLGIFWVSCEAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDES
210-280
YLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALM
280-350
TTAVISTCDHGIVAKIKRVIMERDTYPRKWGLGPKASQKKLMIKQGLLDKHGKPTDSTPATWKQEYVDYS
350-420
ESAKKEVVAEVVKAPQVVAEAAKTAKRKRESESESDETPPAAPQLIKKEKKKSKKDKKAKAGLESGAEPG
420-490
DGDSDTTKKKKKKKKAKEVELVSE
490-514
MADAEVIILPKKHKKKKERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGIVRLHNAIEGGTQLSRALETLTGALFQRPPLIAAVKRQLRVRTIYESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDHGIVAKIKRVIMERDTYPRKWGLGPKASQKKLMIKQGLLDKHGKPTDSTPATWKQEYVDYSESAKKEVVAEVVKAPQVVAEAAKTAKRKRESESESDETPPAAPQLIKKEKKKSKKDKKAKAGLESGAEPGDGDSDTTKKKKKKKKAKEVELVSE