You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LPXN
Leupaxin

Protein Summary
Description
Transcriptional coactivator for androgen receptor (AR) and serum response factor (SRF). Contributes to the regulation of cell adhesion, spreading and cell migration and acts as a negative regulator in integrin-mediated cell adhesion events. Suppresses the integrin-induced tyrosine phosphorylation of paxillin (PXN). May play a critical role as an adapter protein in the formation of the adhesion zone in osteoclasts. Negatively regulates B-cell antigen receptor (BCR) signaling. The product encoded by this gene is preferentially expressed in hematopoietic cells and belongs to the paxillin protein family. Similar to other members of this focal-adhesion-associated adaptor-protein family, it has four leucine-rich LD-motifs in the N-terminus and four LIM domains in the C-terminus. It may function in cell type-specific signaling by associating with PYK2, a member of focal adhesion kinase family. As a substrate for a tyrosine kinase in lymphoid cells, this protein may also function in, and be re ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000395074
  • ENSP00000378512
  • ENSG00000110031
  • ENST00000528954
  • ENSP00000431284

Symbol
  • LDLP
  • LDPL
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.93
disease perturbation
0.87
transcription factor perturbation
0.74
transcription factor
0.73
kinase perturbation
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 167.72   (req: < 5)
Gene RIFs: 16   (req: <= 3)
Antibodies: 164   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 167.72   (req: >= 5)
Gene RIFs: 16   (req: > 3)
Antibodies: 164   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
PathwayCommons: panther
Angiogenesis
PathwayCommons: panther
VEGF signaling pathway
PathwayCommons: netpath
TCR
PathwayCommons: netpath
AndrogenReceptor
Name
Explore in Pharos
Explore in Source
Angiogenesis
VEGF signaling pathway
TCR
AndrogenReceptor
Gene Ontology Terms (18)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (83)
1 – 10 of 83
PLEKHH2
Tdark
Novelty: 0.31230284
p_int: 0.999999955
p_ni: 2.1e-8
p_wrong: 2.3e-8
Score: 0.381
Data Source: BioPlex,STRINGDB
PTPN12
Tchem
Family: Enzyme
Novelty: 0.01537047
p_int: 0.999999804
p_ni: 1.96e-7
Score: 0.844
Data Source: BioPlex,STRINGDB
PTK2
Tclin
Family: Kinase
Novelty: 0.00082373
p_int: 0.999999767
p_ni: 2.3e-7
p_wrong: 3e-9
Score: 0.815
Data Source: BioPlex,STRINGDB
ARHGEF6
Tbio
Novelty: 0.02426496
p_int: 0.999999766
p_ni: 2.34e-7
Score: 0.765
Data Source: BioPlex,STRINGDB
GIT2
Tbio
Family: Enzyme
Novelty: 0.01986426
p_int: 0.999999723
p_ni: 2.77e-7
Score: 0.612
Data Source: BioPlex,STRINGDB
PSTPIP2
Tbio
Family: Enzyme
Novelty: 0.07612143
p_int: 0.999999707
p_ni: 2.61e-7
p_wrong: 3.2e-8
Score: 0.844
Data Source: BioPlex,STRINGDB
PLEKHH1
Tdark
Novelty: 1.875
p_int: 0.999999582
p_ni: 4.15e-7
p_wrong: 3e-9
Score: 0.223
Data Source: BioPlex,STRINGDB
ARHGEF7
Tbio
Novelty: 0.0073993
p_int: 0.999998738
p_ni: 0.000001262
Score: 0.653
Data Source: BioPlex,STRINGDB
PCNT
Tbio
Novelty: 0.00310602
p_int: 0.999998421
p_ni: 0.000001579
Data Source: BioPlex
GIT1
Tbio
Family: Enzyme
Novelty: 0.01299019
p_int: 0.999996716
p_ni: 0.000003284
Score: 0.452
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  167.72

PubMed score by year
PubTator Score  11.93

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQLVYTTNIQELN
1-70
VYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSMLGGLEQELQ
70-140
DLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPR
140-210
CAYCAAPILDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLEN
210-280
YLSAMDTVWHPECFVCGDCFTSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHP
280-350
EHFVCAFCLTQLSKGIFREQNDKTYCQPCFNKLFPL
350-386
MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQLVYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCFTSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHPEHFVCAFCLTQLSKGIFREQNDKTYCQPCFNKLFPL