Protein Classes
Protein Summary
Transcriptional coactivator for androgen receptor (AR) and serum response factor (SRF). Contributes to the regulation of cell adhesion, spreading and cell migration and acts as a negative regulator in integrin-mediated cell adhesion events. Suppresses the integrin-induced tyrosine phosphorylation of paxillin (PXN). May play a critical role as an adapter protein in the formation of the adhesion zone in osteoclasts. Negatively regulates B-cell antigen receptor (BCR) signaling. The product encoded by this gene is preferentially expressed in hematopoietic cells and belongs to the paxillin protein family. Similar to other members of this focal-adhesion-associated adaptor-protein family, it has four leucine-rich LD-motifs in the N-terminus and four LIM domains in the C-terminus. It may function in cell type-specific signaling by associating with PYK2, a member of focal adhesion kinase family. As a substrate for a tyrosine kinase in lymphoid cells, this protein may also function in, and be re ...more
- ENST00000395074
- ENSP00000378512
- ENSG00000110031
- ENST00000528954
- ENSP00000431284
- LDLP
- LDPL
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
|---|---|---|---|
transcription factor binding site profile | 0.93 | ||
disease perturbation | 0.87 | ||
transcription factor perturbation | 0.74 | ||
transcription factor | 0.73 | ||
kinase perturbation | 0.71 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 167.72 (req: < 5)
Gene RIFs: 16 (req: <= 3)
Antibodies: 164 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 167.72 (req: >= 5)
Gene RIFs: 16 (req: > 3)
Antibodies: 164 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 8
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id | Ligand | Method | Resolution (Å) | M.W. (kDa) | Pub Year | Title |
|---|
PDB Structure Id | M.W. | Resolution | Pub Year |
|---|
Pathways (4)
PathwayCommons (4)
Items per page:
1 – 4 of 4
Data Source | Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|---|
PathwayCommons: panther | Angiogenesis | ||||
PathwayCommons: panther | VEGF signaling pathway | ||||
PathwayCommons: netpath | TCR | ||||
PathwayCommons: netpath | AndrogenReceptor | ||||
Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|
Angiogenesis | ||||
VEGF signaling pathway | ||||
TCR | ||||
AndrogenReceptor | ||||
Gene Ontology Terms (18)
Functions (2)
Components (10)
Processes (6)
Items per page:
10
1 – 2 of 2
GO Term | Evidence | Assigned by | ||
|---|---|---|---|---|
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Electronic Annotation (IEA) | UniProtKB-KW | |||
Protein-Protein Interactions (83)
1 – 10 of 83
PLEKHH2
Novelty: 0.31230284
p_int: 0.999999955
p_ni: 2.1e-8
p_wrong: 2.3e-8
Score: 0.381
Data Source: BioPlex,STRINGDB
PTPN12
Family: Enzyme
Novelty: 0.01537047
p_int: 0.999999804
p_ni: 1.96e-7
Score: 0.844
Data Source: BioPlex,STRINGDB
PTK2
Family: Kinase
Novelty: 0.00082373
p_int: 0.999999767
p_ni: 2.3e-7
p_wrong: 3e-9
Score: 0.815
Data Source: BioPlex,STRINGDB
ARHGEF6
Novelty: 0.02426496
p_int: 0.999999766
p_ni: 2.34e-7
Score: 0.765
Data Source: BioPlex,STRINGDB
GIT2
Family: Enzyme
Novelty: 0.01986426
p_int: 0.999999723
p_ni: 2.77e-7
Score: 0.612
Data Source: BioPlex,STRINGDB
PSTPIP2
Family: Enzyme
Novelty: 0.07612143
p_int: 0.999999707
p_ni: 2.61e-7
p_wrong: 3.2e-8
Score: 0.844
Data Source: BioPlex,STRINGDB
PLEKHH1
Novelty: 1.875
p_int: 0.999999582
p_ni: 4.15e-7
p_wrong: 3e-9
Score: 0.223
Data Source: BioPlex,STRINGDB
ARHGEF7
Novelty: 0.0073993
p_int: 0.999998738
p_ni: 0.000001262
Score: 0.653
Data Source: BioPlex,STRINGDB
PCNT
Novelty: 0.00310602
p_int: 0.999998421
p_ni: 0.000001579
Data Source: BioPlex
GIT1
Family: Enzyme
Novelty: 0.01299019
p_int: 0.999996716
p_ni: 0.000003284
Score: 0.452
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score 167.72
PubMed score by year
PubTator Score 11.93
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQLVYTTNIQELN
1-70
VYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSMLGGLEQELQ
70-140
DLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPR
140-210
CAYCAAPILDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLEN
210-280
YLSAMDTVWHPECFVCGDCFTSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHP
280-350
EHFVCAFCLTQLSKGIFREQNDKTYCQPCFNKLFPL
350-386
MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQLVYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCFTSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHPEHFVCAFCLTQLSKGIFREQNDKTYCQPCFNKLFPL
Find similar targets by: