You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NRP2
Neuropilin-2

Protein Summary
Description
High affinity receptor for semaphorins 3C, 3F, VEGF-165 and VEGF-145 isoforms of VEGF, and the PLGF-2 isoform of PGF. (Microbial infection) Acts as a receptor for human cytomegalovirus pentamer-dependent entry in epithelial and endothelial cells. This gene encodes a member of the neuropilin family of receptor proteins. The encoded transmembrane protein binds to SEMA3C protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C} and SEMA3F protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F}, and interacts with vascular endothelial growth factor (VEGF). This protein may play a role in cardiovascular development, axon guidance, and tumorigenesis. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000272849
  • ENSP00000272849
  • ENSG00000118257
  • ENST00000357118
  • ENSP00000349632
  • ENST00000357785
  • ENSP00000350432
  • ENST00000360409
  • ENSP00000353582
  • ENST00000412873
  • ENSP00000407626
  • ENST00000417189
  • ENSP00000387519

Symbol
  • VEGF165R2
  • NP2
  • NPN2
  • PRO2714
  • VEGF165R2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.98
PubMedID
0.96
protein domain
0.92
molecular function
0.91
microRNA
0.82


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 116.52   (req: < 5)
Gene RIFs: 78   (req: <= 3)
Antibodies: 414   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 116.52   (req: >= 5)
Gene RIFs: 78   (req: > 3)
Antibodies: 414   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 34
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (10)
1 – 5 of 10
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (131)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Developmental Biology
Reactome
L1CAM interactions
Reactome
Neurophilin interactions with VEGF and VEGFR
Reactome
NrCAM interactions
Name
Explore in Pharos
Explore in Source
Axon guidance
Developmental Biology
L1CAM interactions
Neurophilin interactions with VEGF and VEGFR
NrCAM interactions
Gene Ontology Terms (42)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Traceable Author Statement (TAS)
BHF-UCL
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Non-traceable Author Statement (NAS)
BHF-UCL
Non-traceable Author Statement (NAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (89)
1 – 10 of 89
UPK2
Tbio
Novelty: 0.0107781
p_int: 0.999899229
p_ni: 0.000100771
Data Source: BioPlex
COL20A1
Tdark
Novelty: 1.49268293
p_int: 0.988263745
p_ni: 0.011736252
p_wrong: 3e-9
Data Source: BioPlex
ST8SIA3
Tbio
Family: Enzyme
Novelty: 0.0404064
p_int: 0.98429353
p_ni: 0.01570647
Score: 0.219
Data Source: BioPlex,STRINGDB
CSTL1
Tdark
Novelty: 0.27027027
p_int: 0.973422932
p_ni: 0.025363597
p_wrong: 0.00121347
Data Source: BioPlex
DEFA5
Tbio
Novelty: 0.01045537
p_int: 0.968098837
p_ni: 0.031901163
Data Source: BioPlex
NXPH2
Tdark
Novelty: 0.61538462
p_int: 0.945280178
p_ni: 0.052367715
p_wrong: 0.002352108
Data Source: BioPlex
BRINP3
Tbio
Novelty: 0.08723798
p_int: 0.939732921
p_ni: 0.057898424
p_wrong: 0.002368655
Data Source: BioPlex
ATP1B3
Tclin
Family: Transporter
Novelty: 0.07056603
p_int: 0.938323277
p_ni: 0.058795743
p_wrong: 0.00288098
Data Source: BioPlex
ST8SIA4
Tbio
Family: Enzyme
Novelty: 0.00575428
p_int: 0.93756809
p_ni: 0.059284137
p_wrong: 0.003147774
Score: 0.498
Data Source: BioPlex,STRINGDB
TSPAN11
Tdark
Novelty: 0.6
p_int: 0.936551964
p_ni: 0.063445861
p_wrong: 0.000002175
Score: 0.2
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  116.52

PubMed score by year
PubTator Score  223.4

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDMFPLTWVFLALYFSRHQVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVL
1-70
NFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDYARQGAGFSLRYE
70-140
IFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLEHDPLQVGEGDCKY
140-210
DWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVP
210-280
LGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISR
280-350
ETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIAL
350-420
RLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQV
420-490
DLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDI
490-560
RRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPTVETLGPTVKSEETTTPYPTEEEATECGENC
560-630
SFEDDKDLQLPSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYA
630-700
RLISPPVHLPRSPVCMEFQYQATGGRGVALQVVREASQESKLLWVIREDQGGEWKHGRIILPSYDMEYQI
700-770
VFEGVIGKGRSGEIAIDDIRISTDVPLENCMEPISAFAGENFKVDIPEIHEREGYEDEIDDEYEVDWSNS
770-840
SSATSGSGAPSTDKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSRSCTTLENYNF
840-910
ELYDGLKHKVKMNHQKCCSEA
910-931
MDMFPLTWVFLALYFSRHQVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPTVETLGPTVKSEETTTPYPTEEEATECGENCSFEDDKDLQLPSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVCMEFQYQATGGRGVALQVVREASQESKLLWVIREDQGGEWKHGRIILPSYDMEYQIVFEGVIGKGRSGEIAIDDIRISTDVPLENCMEPISAFAGENFKVDIPEIHEREGYEDEIDDEYEVDWSNSSSATSGSGAPSTDKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSRSCTTLENYNFELYDGLKHKVKMNHQKCCSEA