You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ADCY3
Adenylate cyclase type 3

Protein Summary
Description
Catalyzes the formation of the signaling molecule cAMP in response to G-protein signaling. Participates in signaling cascades triggered by odorant receptors via its function in cAMP biosynthesis. Required for the perception of odorants. Required for normal sperm motility and normal male fertility. Plays a role in regulating insulin levels and body fat accumulation in response to a high fat diet. This gene encodes adenylyl cyclase 3 which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This protein appears to be widely expressed in various human tissues and may be involved in a number of physiological and pathophysiological metabolic processes. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000260600
  • ENSP00000260600
  • ENSG00000138031

Symbol
  • KIAA0511
  • AC3
  • AC-III
  • BMIQ19
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.96
co-expressed gene
0.96
molecular function
0.93
cell type or tissue
0.89
kinase perturbation
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 263.48   (req: < 5)
Gene RIFs: 19   (req: <= 3)
Antibodies: 124   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 263.48   (req: >= 5)
Gene RIFs: 19   (req: > 3)
Antibodies: 124   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 17
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (107)
Activation of GABAB receptors (R-HSA-991365)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 33
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of GABAB receptors
Reactome
Adenylate cyclase activating pathway
Reactome
Adenylate cyclase inhibitory pathway
Reactome
Aquaporin-mediated transport
Reactome
Ca-dependent events
Name
Explore in Pharos
Explore in Source
Activation of GABAB receptors
Adenylate cyclase activating pathway
Adenylate cyclase inhibitory pathway
Aquaporin-mediated transport
Ca-dependent events
Gene Ontology Terms (24)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (526)
1 – 10 of 526
ANKMY2
Tdark
Novelty: 1.16129032
p_int: 0.999995141
p_ni: 0.000004859
Score: 0.232
Data Source: BioPlex,STRINGDB
SLC4A8
Tbio
Family: Transporter
Novelty: 0.00405991
p_int: 0.998990486
p_ni: 0.001009512
p_wrong: 2e-9
Score: 0.159
Data Source: BioPlex,STRINGDB
ASIC4
Tbio
Family: IC
Novelty: 0.05388991
p_int: 0.998913445
p_ni: 0.001086553
p_wrong: 2e-9
Data Source: BioPlex
RXFP1
Tchem
Family: GPCR
Novelty: 0.00590091
p_int: 0.998669634
p_ni: 0.001330358
p_wrong: 7e-9
Score: 0.905
Data Source: BioPlex,STRINGDB
LGALS3
Tchem
Novelty: 0.00032884
p_int: 0.996493614
p_ni: 0.003475574
p_wrong: 0.000030811
Data Source: BioPlex
CNGA3
Tchem
Family: IC
Novelty: 0.00973676
p_int: 0.996491387
p_ni: 0.003484416
p_wrong: 0.000024198
Score: 0.376
Data Source: BioPlex,STRINGDB
IL17RC
Tclin
Novelty: 0.02676926
p_int: 0.989974863
p_ni: 0.010023416
p_wrong: 0.00000172
Score: 0.172
Data Source: BioPlex,STRINGDB
PCDHGA5
Tdark
p_int: 0.977077602
p_ni: 0.022918841
p_wrong: 0.000003558
Data Source: BioPlex
CD79B
Tclin
Novelty: 0.00265318
p_int: 0.964618805
p_ni: 0.033883702
p_wrong: 0.001497493
Data Source: BioPlex
IZUMO1
Tbio
Novelty: 0.00670282
p_int: 0.954306154
p_ni: 0.045171519
p_wrong: 0.000522327
Data Source: BioPlex
Publication Statistics
PubMed Score  263.48

PubMed score by year
PubTator Score  91.34

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPESLENLYQTYF
1-70
KRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLASLAVAGIGLVLDIILFVLCKKGLLPDRVTRRVLP
70-140
YVLWLLITAQIFSYLGLNFARAHAASDTVGWQVFFVFSFFITLPLSLSPIVIISVVSCVVHTLVLGVTVA
140-210
QQQQEELKGMQLLREILANVFLYLCAIAVGIMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLML
210-280
SILPKHVADEMLKDMKKDESQKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFAR
280-350
FDKLAAKYHQLRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
350-420
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCDYLEEKGIETY
420-490
LIIASKPEVKKTATQNGLNGSALPNGAPASSKSSSPALIETKEPNGSAHSSGSTSEKPEEQDAQADNPSF
490-560
PNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQVVKKRNTFLLSMRFMDPEMETRYSVEKEK
560-630
QSGAAFSCSCVVLLCTALVEILIDPWLMTNYVTFMVGEILLLILTICSLAAIFPRAFPKKLVAFSTWIDR
630-700
TRWARNTWAMLAIFILVMANVVDMLSCLQYYTGPSNATAGMETEGSCLENPKYYNYVAVLSLIATIMLVQ
700-770
VSHMVKLTLMLLVAGAVATINLYAWRPVFDEYDHKRFREHDLPMVALEQMQGFNPGLNGTDRLPLVPSKY
770-840
SMTVMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKR
840-910
DEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSLLDNPKFRVITKIKTIGST
910-980
YMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADFALAMKDTLTNINNQSFNNFMLRIGMNKGGVL
980-1050
AGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLK
1050-1120
GRDKLATFPNGPSVTLPHQVVDNS
1120-1144
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPESLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLASLAVAGIGLVLDIILFVLCKKGLLPDRVTRRVLPYVLWLLITAQIFSYLGLNFARAHAASDTVGWQVFFVFSFFITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQEELKGMQLLREILANVFLYLCAIAVGIMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDESQKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQLRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCDYLEEKGIETYLIIASKPEVKKTATQNGLNGSALPNGAPASSKSSSPALIETKEPNGSAHSSGSTSEKPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTNYVTFMVGEILLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMANVVDMLSCLQYYTGPSNATAGMETEGSCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLMLLVAGAVATINLYAWRPVFDEYDHKRFREHDLPMVALEQMQGFNPGLNGTDRLPLVPSKYSMTVMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADFALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGPSVTLPHQVVDNS