You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PLIN1
Perilipin-1

Protein Summary
Description
Modulator of adipocyte lipid metabolism. Coats lipid storage droplets to protect them from breakdown by hormone-sensitive lipase (HSL). Its absence may result in leanness. Plays a role in unilocular lipid droplet formation by activating CIDEC. Their interaction promotes lipid droplet enlargement and directional net neutral lipid transfer. May modulate lipolysis and triglyceride levels. The protein encoded by this gene coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The encoded protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis. Alternatively spliced transcript variants varying in the 5' UTR, but encoding the same protein, have been found for this gene. [provided by RefSeq, Feb 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000300055
  • ENSP00000300055
  • ENSG00000166819
  • ENST00000430628
  • ENSP00000402167

Symbol
  • PERI
  • PLIN
  • PERI
  • PLIN
  • FPLD4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.68
biological term
0.66
cell line
0.63
microRNA
0.56
chemical
0.53


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 552.94   (req: < 5)
Gene RIFs: 66   (req: <= 3)
Antibodies: 323   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 552.94   (req: >= 5)
Gene RIFs: 66   (req: > 3)
Antibodies: 323   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (34)
Developmental Biology (R-HSA-1266738)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Developmental Biology
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Transcriptional regulation of white adipocyte differentiation
Reactome
Triglyceride catabolism
Name
Explore in Pharos
Explore in Source
Developmental Biology
Metabolism
Metabolism of lipids
Transcriptional regulation of white adipocyte differentiation
Triglyceride catabolism
Gene Ontology Terms (6)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Non-traceable Author Statement (NAS)
UniProtKB
Protein-Protein Interactions (138)
1 – 10 of 138
LIPE
Tchem
Family: Enzyme
Novelty: 0.00159068
Score: 0.994
Data Source: STRINGDB
ABHD5
Tbio
Family: Enzyme
Novelty: 0.00998736
Score: 0.994
Data Source: Reactome,STRINGDB
PPARG
Tclin
Family: NR
Novelty: 0.00012454
Score: 0.983
Data Source: STRINGDB
FABP4
Tchem
Novelty: 0.00130496
Score: 0.973
Data Source: STRINGDB
PPARGC1A
Tbio
Novelty: 0.00121082
Score: 0.944
Data Source: STRINGDB
CAV1
Tbio
Novelty: 0.00041332
Score: 0.944
Data Source: STRINGDB
PRKACA
Tchem
Family: Kinase
Novelty: 0.05996003
Score: 0.935
Data Source: Reactome,STRINGDB
CIDEC
Tbio
Novelty: 0.01333028
Score: 0.933
Data Source: STRINGDB
HDAC3
Tclin
Family: Epigenetic
Novelty: 0.00453537
Score: 0.927
Data Source: STRINGDB
MED28
Tbio
Family: Enzyme
Novelty: 0.00538886
Score: 0.922
Data Source: STRINGDB
Publication Statistics
PubMed Score  552.94

PubMed score by year
PubTator Score  540.03

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAVNKGLTLLDGDLPEQENVLQRVLQLPVVSGTCECFQKTYTSTKEAHPLVASVCNAYEKGVQSASSLAA
1-70
WSMEPVVRRLSTQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNSISVPIASTSD
70-140
KVLGAALAGCELAWGVARDTAEFAANTRAGRLASGGADLALGSIEKVVEYLLPPDKEESAPAPGHQQAQK
140-210
SPKAKPSLLSRVGALTNTLSRYTVQTMARALEQGHTVAMWIPGVVPLSSLAQWGASVAMQAVSRRRSEVR
210-280
VPWLHSLAAAQEEDHEDQTDTEGEDTEEEEELETEENKFSEVAALPGPRGLLGGVAHTLQKTLQTTISAV
280-350
TWAPAAVLGMAGRVLHLTPAPAVSSTKGRAMSLSDALKGVTDNVVDTVVHYVPLPRLSLMEPESEFRDID
350-420
NPPAEVERREAERRASGAPSAGPEPAPRLAQPRRSLRSAQSPGAPPGPGLEDEVATPAAPRPGFPAVPRE
420-490
KPKRRVSDSFFRPSVMEPILGRTHYSQLRKKS
490-522
MAVNKGLTLLDGDLPEQENVLQRVLQLPVVSGTCECFQKTYTSTKEAHPLVASVCNAYEKGVQSASSLAAWSMEPVVRRLSTQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNSISVPIASTSDKVLGAALAGCELAWGVARDTAEFAANTRAGRLASGGADLALGSIEKVVEYLLPPDKEESAPAPGHQQAQKSPKAKPSLLSRVGALTNTLSRYTVQTMARALEQGHTVAMWIPGVVPLSSLAQWGASVAMQAVSRRRSEVRVPWLHSLAAAQEEDHEDQTDTEGEDTEEEEELETEENKFSEVAALPGPRGLLGGVAHTLQKTLQTTISAVTWAPAAVLGMAGRVLHLTPAPAVSSTKGRAMSLSDALKGVTDNVVDTVVHYVPLPRLSLMEPESEFRDIDNPPAEVERREAERRASGAPSAGPEPAPRLAQPRRSLRSAQSPGAPPGPGLEDEVATPAAPRPGFPAVPREKPKRRVSDSFFRPSVMEPILGRTHYSQLRKKS