You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TYROBP
TYRO protein tyrosine kinase-binding protein

Protein Summary
Description
Non-covalently associates with activating receptors of the CD300 family. Cross-linking of CD300-TYROBP complexes results in cellular activation. Involved for instance in neutrophil activation mediated by integrin. This gene encodes a transmembrane signaling polypeptide which contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. The encoded protein may associate with the killer-cell inhibitory receptor (KIR) family of membrane glycoproteins and may act as an activating signal transduction element. This protein may bind zeta-chain (TCR) associated protein kinase 70kDa (ZAP-70) and spleen tyrosine kinase (SYK) and play a role in signal transduction, bone modeling, brain myelination, and inflammation. Mutations within this gene have been associated with polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL), also known as Nasu-Hakola disease. Its putative receptor, triggering receptor expressed on myeloid cells 2 (TREM2), ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000262629
  • ENSP00000262629
  • ENSG00000011600
  • ENST00000544690
  • ENSP00000445332
  • ENST00000589517
  • ENSP00000468447

Symbol
  • DAP12
  • KARAP
  • DAP12
  • KARAP
  • PLOSL
  • PLOSL1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.91
tissue sample
0.71
disease perturbation
0.68
co-expressed gene
0.65
tissue
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 195.5   (req: < 5)
Gene RIFs: 46   (req: <= 3)
Antibodies: 264   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 195.5   (req: >= 5)
Gene RIFs: 46   (req: > 3)
Antibodies: 264   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (19)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Axon guidance
Reactome
Cell-Cell communication
Reactome
DAP12 interactions
Reactome
DAP12 signaling
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Axon guidance
Cell-Cell communication
DAP12 interactions
DAP12 signaling
Gene Ontology Terms (16)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
UniProtKB
Protein-Protein Interactions (397)
1 – 10 of 397
SMAD5
Tbio
Family: TF
Novelty: 0.00607935
p_int: 0.99996282
p_ni: 0.000026625
p_wrong: 0.000010555
Data Source: BioPlex
MTHFR
Tbio
Family: Enzyme
Novelty: 0.00020963
p_int: 0.999792974
p_ni: 0.000207025
Data Source: BioPlex
SLC35B2
Tbio
Family: Transporter
Novelty: 0.00442602
p_int: 0.998738888
p_ni: 0.001261062
p_wrong: 5e-8
Data Source: BioPlex
GBF1
Tbio
Novelty: 0.22672065
p_int: 0.998348475
p_ni: 0.001651525
Data Source: BioPlex
EXTL2
Tbio
Family: Enzyme
Novelty: 0.08013738
p_int: 0.994007716
p_ni: 0.003139563
p_wrong: 0.002852721
Data Source: BioPlex
DNM2
Tchem
Novelty: 0.00331333
p_int: 0.990984016
p_ni: 0.009015984
Data Source: BioPlex
DNM3
Tbio
Novelty: 0.03060558
p_int: 0.98549997
p_ni: 0.01450003
Data Source: BioPlex
TMX4
Tdark
Novelty: 0.875
p_int: 0.984847467
p_ni: 0.015152532
p_wrong: 1e-9
Data Source: BioPlex
RETREG3
Tdark
Novelty: 1.68674699
p_int: 0.952524353
p_ni: 0.047475647
Data Source: BioPlex
GPIHBP1
Tbio
Novelty: 0.01411894
p_int: 0.947512872
p_ni: 0.00404445
p_wrong: 0.048442677
Data Source: BioPlex
Publication Statistics
PubMed Score  195.50

PubMed score by year
PubTator Score  130

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPR
1-70
GRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK
70-113
MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK