You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CALU
Calumenin

Protein Summary
Description
Involved in regulation of vitamin K-dependent carboxylation of multiple N-terminal glutamate residues. Seems to inhibit gamma-carboxylase GGCX. Binds 7 calcium ions with a low affinity (By similarity). The product of this gene is a calcium-binding protein localized in the endoplasmic reticulum (ER) and it is involved in such ER functions as protein folding and sorting. This protein belongs to a family of multiple EF-hand proteins (CERC) that include reticulocalbin, ERC-55, and Cab45 and the product of this gene. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2008]
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.99
disease perturbation
0.97
kinase perturbation
0.93
microRNA
0.93
interacting protein
0.87


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 73.66   (req: < 5)
Gene RIFs: 19   (req: <= 3)
Antibodies: 240   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 73.66   (req: >= 5)
Gene RIFs: 19   (req: > 3)
Antibodies: 240   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (16)
Hemostasis (R-HSA-109582)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Hemostasis
Reactome
Metabolism of proteins
Reactome
Platelet activation, signaling and aggregation
Reactome
Platelet degranulation
Reactome
Post-translational protein modification
Name
Explore in Pharos
Explore in Source
Hemostasis
Metabolism of proteins
Platelet activation, signaling and aggregation
Platelet degranulation
Post-translational protein modification
Gene Ontology Terms (11)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (198)
1 – 10 of 198
IGF2
Tbio
Novelty: 0.00024884
p_int: 0.999758178
p_ni: 0.000241823
Data Source: BioPlex
MRPS7
Tbio
Novelty: 0.00146168
p_int: 0.912880822
p_ni: 0.087119178
Score: 0.249
Data Source: BioPlex,STRINGDB
HIC2
Tbio
Family: TF
Novelty: 0.39202376
p_int: 0.808319625
p_ni: 0.175428987
p_wrong: 0.016251388
Score: 0.282
Data Source: BioPlex,STRINGDB
P4HB
Tbio
Family: Enzyme
Novelty: 0.00117072
Score: 0.991
Data Source: STRINGDB
HSP90B1
Tchem
Novelty: 0.00167817
Score: 0.964
Data Source: STRINGDB
PDIA6
Tchem
Family: Enzyme
Novelty: 0.02339159
Score: 0.947
Data Source: STRINGDB
ALB
Tchem
Novelty: 0.0000092
Score: 0.945
Data Source: STRINGDB
PCSK9
Tclin
Family: Enzyme
Novelty: 0.00047935
Score: 0.943
Data Source: STRINGDB
FN1
Tchem
Novelty: 0.0000437
Score: 0.937
Data Source: STRINGDB
FGA
Tbio
Novelty: 0.00122914
Score: 0.935
Data Source: STRINGDB
Publication Statistics
PubMed Score  73.66

PubMed score by year
PubTator Score  42.02

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESK
1-70
ERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDD
70-140
PDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDL
140-210
EEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQN
210-280
KDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF
280-315
MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESKERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF