You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GSTZ1
Maleylacetoacetate isomerase

Protein Summary
Description
Bifunctional enzyme showing minimal glutathione-conjugating activity with ethacrynic acid and 7-chloro-4-nitrobenz-2-oxa-1,3-diazole and maleylacetoacetate isomerase activity. Has also low glutathione peroxidase activity with T-butyl and cumene hydroperoxides. Is able to catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid. This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme catalyzes the conversion of maleylacetoacetate to fumarylacetoacatate, which is one of the steps in the phenylalanine/tyrosine degradation pathway. Deficiency of a similar gene in mouse causes oxidative stress. Several transcript variants of this gene encode multiple protein isoforms. [provided by RefSeq, Jul 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000361389
  • ENSP00000354959
  • ENSG00000100577
  • ENST00000393734
  • ENSP00000377335
  • ENST00000557639
  • ENSP00000451927

Symbol
  • MAAI
  • MAI
  • MAAI
  • MAAID
  • GSTZ1-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.94
disease perturbation
0.93
kinase perturbation
0.88
histone modification site profile
0.76
protein domain
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 102.94   (req: < 5)
Gene RIFs: 32   (req: <= 3)
Antibodies: 189   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 102.94   (req: >= 5)
Gene RIFs: 32   (req: > 3)
Antibodies: 189   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (26)
Biological oxidations (R-HSA-211859)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Biological oxidations
Reactome
Glutathione conjugation
Reactome
Metabolism
Reactome
Metabolism of amino acids and derivatives
Reactome
Phase II - Conjugation of compounds
Name
Explore in Pharos
Explore in Source
Biological oxidations
Glutathione conjugation
Metabolism
Metabolism of amino acids and derivatives
Phase II - Conjugation of compounds
Gene Ontology Terms (14)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (52)
1 – 10 of 52
RBPMS
Tbio
Novelty: 0.03007893
p_int: 0.916694443
p_ni: 0.083305557
Score: 0.528
Data Source: BioPlex,STRINGDB
FAH
Tbio
Family: Enzyme
Novelty: 0.00529007
Score: 0.991
Data Source: STRINGDB
HGD
Tbio
Family: Enzyme
Novelty: 0.00213809
Score: 0.991
Data Source: STRINGDB
GGH
Tchem
Family: Enzyme
Novelty: 0.00341456
Score: 0.905
Data Source: STRINGDB
GSTP1
Tchem
Family: Enzyme
Novelty: 0.00058001
Score: 0.793
Data Source: STRINGDB
HPGDS
Tchem
Family: Enzyme
Novelty: 0.00017173
Score: 0.768
Data Source: STRINGDB
GSTT2B
Tbio
Family: Enzyme
Novelty: 0.02896495
Score: 0.75
Data Source: STRINGDB
GSTM2
Tchem
Family: Enzyme
Novelty: 0.00495564
Score: 0.732
Data Source: STRINGDB
POMT2
Tbio
Family: Enzyme
Novelty: 0.03313606
Score: 0.712
Data Source: STRINGDB
GSTM1
Tbio
Family: Enzyme
Novelty: 0.00042394
Score: 0.697
Data Source: STRINGDB
Publication Statistics
PubMed Score  102.94

PubMed score by year
PubTator Score  84.77

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQAGKPILYSYFRSSCSWRVRIALALKGIDYKTVPINLIKDRGQQFSKDFQALNPMKQVPTLKIDGITIH
1-70
QSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFN
70-140
ALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDT
140-210
PTELRA
210-216
MQAGKPILYSYFRSSCSWRVRIALALKGIDYKTVPINLIKDRGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA