You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RGS10
Regulator of G-protein signaling 10

Protein Summary
Description
Regulates G protein-coupled receptor signaling cascades, including signaling downstream of the muscarinic acetylcholine receptor CHRM2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form (PubMed:8774883, PubMed:10608901, PubMed:9353196, PubMed:11443111, PubMed:18434541). Modulates the activity of potassium channels that are activated in response to CHRM2 signaling (PubMed:11443111). Activity on GNAZ is inhibited by palmitoylation of the G-protein (PubMed:9353196). Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 10 belongs to this family. All RGS proteins share a conserved ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369101
  • ENSP00000358097
  • ENSG00000148908
  • ENST00000369103
  • ENSP00000358099
  • ENST00000392865
  • ENSP00000376605
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.95
transcription factor perturbation
0.91
PubMedID
0.88
transcription factor
0.88
transcription factor binding site profile
0.88


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 35.32   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 201   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 35.32   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 201   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (15)
G alpha (i) signalling events (R-HSA-418594)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
Signal Transduction
Reactome
Signaling by GPCR
Name
Explore in Pharos
Explore in Source
G alpha (i) signalling events
GPCR downstream signalling
Signal Transduction
Signaling by GPCR
Protein-Protein Interactions (39)
1 – 10 of 39
GNAI3
Tbio
Novelty: 0.03936457
Score: 0.997
Data Source: STRINGDB
GNAI1
Tbio
Novelty: 0.12575547
Score: 0.972
Data Source: STRINGDB
GNAI2
Tbio
Novelty: 0.04542644
Score: 0.947
Data Source: STRINGDB
GNAT3
Tbio
Novelty: 0.004945
Score: 0.941
Data Source: STRINGDB
GNG7
Tbio
Novelty: 0.131191
Score: 0.801
Data Source: STRINGDB
GNG5
Tbio
Novelty: 0.21523747
Score: 0.8
Data Source: STRINGDB
GNG8
Tdark
Novelty: 0.00694874
Score: 0.757
Data Source: STRINGDB
GNG12
Tbio
Novelty: 0.19029707
Score: 0.754
Data Source: STRINGDB
GNG11
Tbio
Novelty: 0.14332397
Score: 0.751
Data Source: STRINGDB
GNG3
Tbio
Novelty: 0.16248863
Score: 0.748
Data Source: STRINGDB
Publication Statistics
PubMed Score  35.32

PubMed score by year
PubTator Score  25.46

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQSELCFADIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFK
1-70
KMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLK
70-140
SDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
140-173
MQSELCFADIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT