You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
HCRTR1
Orexin receptor type 1

Protein Summary
Description
Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide (PubMed:9491897, PubMed:26950369). Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding (PubMed:9491897, PubMed:26950369). The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein selectively binds the hypothalamic neuropeptide orexin A. A related gene (HCRTR2) encodes a G-protein coupled receptor that binds orexin A and orexin B. [provided by RefSeq, Jan 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000373706
  • ENSP00000362810
  • ENSG00000121764
  • ENST00000403528
  • ENSP00000384387

Symbol
  • OX1R
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.7
cell line
0.65
histone modification site profile
0.65
molecular function
0.6
protein domain
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 205.18   (req: < 5)
Gene RIFs: 51   (req: <= 3)
Antibodies: 383   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 205.18   (req: >= 5)
Gene RIFs: 51   (req: > 3)
Antibodies: 383   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 1026
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (13)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Orexin and neuropeptides FF and QRFP bind to their respective receptors
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
G alpha (q) signalling events
GPCR downstream signalling
GPCR ligand binding
Orexin and neuropeptides FF and QRFP bind to their respective receptors
Protein-Protein Interactions (191)
1 – 10 of 191
HCRT
Tbio
Novelty: 0.00044523
Score: 0.994
Data Source: Reactome,STRINGDB
NPS
Tbio
Novelty: 0.00011983
Score: 0.972
Data Source: STRINGDB
NTS
Tbio
Novelty: 0.00035891
Score: 0.949
Data Source: STRINGDB
NPFF
Tbio
Novelty: 0.00350925
Score: 0.943
Data Source: STRINGDB
OXT
Tbio
Novelty: 0.00006195
Score: 0.928
Data Source: STRINGDB
NMB
Tbio
Novelty: 0.00867711
Score: 0.928
Data Source: STRINGDB
CCK
Tbio
Novelty: 0.00013779
Score: 0.927
Data Source: STRINGDB
PMCH
Tbio
Novelty: 0.005002
Score: 0.925
Data Source: STRINGDB
TRH
Tbio
Novelty: 0.00054889
Score: 0.923
Data Source: STRINGDB
AVP
Tbio
Novelty: 0.0001163
Score: 0.921
Data Source: STRINGDB
Publication Statistics
PubMed Score  205.18

PubMed score by year
PubTator Score  90.79

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLA
1-70
VWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFI
70-140
ALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDL
140-210
YPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRA
210-280
RAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYAN
280-350
SAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
350-420
TTVLP
420-425
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP