You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CA12
Carbonic anhydrase 12

Protein Summary
Description
Reversible hydration of carbon dioxide. Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Three transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jun 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000178638
  • ENSP00000178638
  • ENSG00000074410
  • ENST00000344366
  • ENSP00000343088

Symbol
  • CAXII
  • CA-XII
  • T18816
  • HsT18816
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.98
kinase perturbation
0.91
virus perturbation
0.85
PubMedID
0.84
gene perturbation
0.83


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 256   (req: < 5)
Gene RIFs: 30   (req: <= 3)
Antibodies: 460   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 256   (req: >= 5)
Gene RIFs: 30   (req: > 3)
Antibodies: 460   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 2029
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 19
Protein Data Bank (16)
1 – 5 of 16
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Reversible hydration of carbon dioxide
Name
Explore in Pharos
Explore in Source
Metabolism
Reversible hydration of carbon dioxide
Gene Ontology Terms (6)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (45)
1 – 10 of 45
TMEM30B
Tbio
Novelty: 0.41265163
p_int: 0.988136691
p_ni: 5e-8
p_wrong: 0.011863259
Score: 0.188
Data Source: BioPlex,STRINGDB
CYP24A1
Tchem
Family: Enzyme
Novelty: 0.00108437
Score: 0.795
Data Source: STRINGDB
UHMK1
Tbio
Family: Kinase
Novelty: 0.00180095
Score: 0.67
Data Source: STRINGDB
HIGD1A
Tbio
Novelty: 0.07704751
Score: 0.626
Data Source: STRINGDB
SLC9A1
Tchem
Family: Transporter
Novelty: 0.00112175
Score: 0.611
Data Source: STRINGDB
SLC4A4
Tbio
Family: Transporter
Novelty: 0.00221797
Score: 0.581
Data Source: STRINGDB
GREB1
Tbio
Novelty: 0.02488332
Score: 0.575
Data Source: STRINGDB
FOXF1
Tbio
Family: TF
Novelty: 0.01072169
Score: 0.571
Data Source: STRINGDB
SNRPB
Tbio
Novelty: 0.01137048
Score: 0.555
Data Source: STRINGDB
TFF1
Tbio
Novelty: 0.00363238
Score: 0.549
Data Source: STRINGDB
Publication Statistics
PubMed Score  256.00

PubMed score by year
PubTator Score  186.98

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDAS
1-70
LTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHF
70-140
AAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEEL
140-210
LPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKF
210-280
DERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMET
280-350
EAHA
350-354
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA