You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
OIP5
Protein Mis18-beta

Protein Summary
Description
Required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis. The protein encoded by this gene localizes to centromeres, where it is essential for recruitment of CENP-A through the mediator Holliday junction recognition protein. Expression of this gene is upregulated in several cancers, making it a putative therapeutic target. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000220514
  • ENSP00000220514
  • ENSG00000104147

Symbol
  • MIS18B
  • CT86
  • MIS18B
  • LINT-25
  • MIS18beta
  • hMIS18beta
  • 5730547N13Rik
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.87
virus perturbation
0.68
transcription factor binding site profile
0.64
tissue sample
0.58
gene perturbation
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.83   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 96   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.83   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 96   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Cell Cycle (R-HSA-1640170)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell Cycle
Reactome
Chromosome Maintenance
Reactome
Deposition of new CENPA-containing nucleosomes at the centromere
Reactome
Nucleosome assembly
Name
Explore in Pharos
Explore in Source
Cell Cycle
Chromosome Maintenance
Deposition of new CENPA-containing nucleosomes at the centromere
Nucleosome assembly
Gene Ontology Terms (15)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (270)
1 – 10 of 270
MIS18A
Tbio
Novelty: 0.00785124
p_int: 1
Score: 0.989
Data Source: BioPlex,Reactome,STRINGDB
CEP170
Tbio
Novelty: 0.00614876
p_int: 0.999999995
p_ni: 5e-9
Data Source: BioPlex
STX1A
Tbio
Novelty: 0.00128938
p_int: 0.999989679
p_ni: 0.000010291
p_wrong: 3e-8
Score: 0.193
Data Source: BioPlex,STRINGDB
TRAF7
Tbio
Family: Enzyme
Novelty: 0.05310289
p_int: 0.999979523
p_ni: 0.000019824
p_wrong: 6.54e-7
Data Source: BioPlex
GTF2E2
Tbio
Novelty: 0.16730745
p_int: 0.999975003
p_ni: 0.000024939
p_wrong: 5.8e-8
Data Source: BioPlex
MIS18BP1
Tbio
Novelty: 0.07604563
p_int: 0.999860708
p_ni: 0.000139279
p_wrong: 1.3e-8
Score: 0.995
Data Source: BioPlex,Reactome,STRINGDB
S100A4
Tbio
Novelty: 0.00156469
p_int: 0.999840441
p_ni: 0.000159337
p_wrong: 2.22e-7
Data Source: BioPlex
MED29
Tbio
Family: Enzyme
Novelty: 0.01553799
p_int: 0.999587127
p_ni: 0.000412861
p_wrong: 1.2e-8
Data Source: BioPlex
G0S2
Tbio
Novelty: 0.02314004
p_int: 0.997858902
p_ni: 0.000420439
p_wrong: 0.001720659
Data Source: BioPlex
PIP
Tbio
Novelty: 0.00268794
p_int: 0.995787728
p_ni: 0.000287674
p_wrong: 0.003924598
Data Source: BioPlex
Publication Statistics
PubMed Score  24.83

PubMed score by year
PubTator Score  22.38

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWL
1-70
QPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSC
70-140
GIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRL
140-210
KSLMKILSEVTPDQSKPEN
210-229
MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN