Protein Summary
Required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis. The protein encoded by this gene localizes to centromeres, where it is essential for recruitment of CENP-A through the mediator Holliday junction recognition protein. Expression of this gene is upregulated in several cancers, making it a putative therapeutic target. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]
- ENST00000220514
- ENSP00000220514
- ENSG00000104147
- MIS18B
- CT86
- MIS18B
- LINT-25
- MIS18beta
- hMIS18beta
- 5730547N13Rik
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
histone modification site profile | 0.87 | ||
virus perturbation | 0.68 | ||
transcription factor binding site profile | 0.64 | ||
tissue sample | 0.58 | ||
gene perturbation | 0.55 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 24.83 (req: < 5)
Gene RIFs: 18 (req: <= 3)
Antibodies: 96 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 24.83 (req: >= 5)
Gene RIFs: 18 (req: > 3)
Antibodies: 96 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 7
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Pathways (4)
Reactome (4)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 4 of 4
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Cell Cycle | ||||
Reactome | Chromosome Maintenance | ||||
Reactome | Deposition of new CENPA-containing nucleosomes at the centromere | ||||
Reactome | Nucleosome assembly | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Cell Cycle | ||||
Chromosome Maintenance | ||||
Deposition of new CENPA-containing nucleosomes at the centromere | ||||
Nucleosome assembly | ||||
Gene Ontology Terms (15)
Functions (2)
Components (8)
Processes (5)
Items per page:
10
1 – 2 of 2
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Physical Interaction (IPI) | IntAct | |||
Inferred from Electronic Annotation (IEA) | UniProtKB-KW | |||
Protein-Protein Interactions (270)
1 – 10 of 270
MIS18A
Novelty: 0.00785124
p_int: 1
Score: 0.989
Data Source: BioPlex,Reactome,STRINGDB
CEP170
Novelty: 0.00614876
p_int: 0.999999995
p_ni: 5e-9
Data Source: BioPlex
STX1A
Novelty: 0.00128938
p_int: 0.999989679
p_ni: 0.000010291
p_wrong: 3e-8
Score: 0.193
Data Source: BioPlex,STRINGDB
TRAF7
Family: Enzyme
Novelty: 0.05310289
p_int: 0.999979523
p_ni: 0.000019824
p_wrong: 6.54e-7
Data Source: BioPlex
GTF2E2
Novelty: 0.16730745
p_int: 0.999975003
p_ni: 0.000024939
p_wrong: 5.8e-8
Data Source: BioPlex
MIS18BP1
Novelty: 0.07604563
p_int: 0.999860708
p_ni: 0.000139279
p_wrong: 1.3e-8
Score: 0.995
Data Source: BioPlex,Reactome,STRINGDB
S100A4
Novelty: 0.00156469
p_int: 0.999840441
p_ni: 0.000159337
p_wrong: 2.22e-7
Data Source: BioPlex
MED29
Family: Enzyme
Novelty: 0.01553799
p_int: 0.999587127
p_ni: 0.000412861
p_wrong: 1.2e-8
Data Source: BioPlex
G0S2
Novelty: 0.02314004
p_int: 0.997858902
p_ni: 0.000420439
p_wrong: 0.001720659
Data Source: BioPlex
PIP
Novelty: 0.00268794
p_int: 0.995787728
p_ni: 0.000287674
p_wrong: 0.003924598
Data Source: BioPlex
Publication Statistics
PubMed Score 24.83
PubMed score by year
PubTator Score 22.38
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWL
1-70
QPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSC
70-140
GIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRL
140-210
KSLMKILSEVTPDQSKPEN
210-229
MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN
Find similar targets by: