You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HTRA2
Serine protease HTRA2, mitochondrial

Protein Summary
Description
Serine protease that shows proteolytic activity against a non-specific substrate beta-casein. Promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. Cleaves THAP5 and promotes its degradation during apoptosis. Isoform 2 seems to be proteolytically inactive. This gene encodes a serine protease. The protein has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed. Alternate splicin ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000258080
  • ENSP00000258080
  • ENSG00000115317
  • ENST00000352222
  • ENSP00000312893

Symbol
  • OMI
  • PRSS25
  • OMI
  • MGCA8
  • PARK13
  • PRSS25
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.97
disease perturbation
0.95
kinase perturbation
0.95
cellular component
0.89
transcription factor binding site profile
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1208.79   (req: < 5)
Gene RIFs: 95   (req: <= 3)
Antibodies: 686   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1208.79   (req: >= 5)
Gene RIFs: 95   (req: > 3)
Antibodies: 686   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 37
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (10)
1 – 5 of 10
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Protein-Protein Interactions (137)
1 – 10 of 137
BIRC8
Tchem
Novelty: 0.10093242
p_int: 0.999805316
p_ni: 0.000194684
Score: 0.596
Data Source: BioPlex,STRINGDB
RMND5A
Tbio
Novelty: 0.02153867
p_int: 0.995000125
p_ni: 0.004999875
Score: 0.543
Data Source: BioPlex,STRINGDB
MMP13
Tchem
Family: Enzyme
Novelty: 0.00068218
p_int: 0.991298641
p_ni: 0.008701359
Data Source: BioPlex
WDYHV1
Tdark
Family: Enzyme
Novelty: 0.23412216
p_int: 0.976573123
p_ni: 0.023426877
Score: 0.207
Data Source: BioPlex,STRINGDB
BIRC7
Tchem
Novelty: 0.00510868
p_int: 0.949306096
p_ni: 0.050693904
Score: 0.866
Data Source: BioPlex,STRINGDB
BIRC2
Tchem
Novelty: 0.00265344
p_int: 0.931009059
p_ni: 0.068990941
Score: 0.984
Data Source: BioPlex,STRINGDB
MRPL4
Tdark
Novelty: 0.75
p_int: 0.906540907
p_ni: 0.093459093
Score: 0.215
Data Source: BioPlex,STRINGDB
XIAP
Tchem
Family: Enzyme
Novelty: 0.00068225
Score: 0.965
Data Source: STRINGDB
PINK1
Tbio
Family: Kinase
Novelty: 0.00128084
Score: 0.946
Data Source: STRINGDB
DIABLO
Tbio
Novelty: 0.00107224
Score: 0.946
Data Source: STRINGDB
Publication Statistics
PubMed Score  1208.79

PubMed score by year
PubTator Score  163.04

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAPRAGRGAGWSLRAWRALGGIRWGRRPRLTPDLRALLTSGTSDPRARVTYGTPSLWARLSVGVTEPRA
1-70
CLTSGTPGPRAQLTAVTPDTRTREASENSGTRSRAWLAVALGAGGAVLLLLWGGGRGPPAVLAAVPSPPP
70-140
ASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRL
140-210
LSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQR
210-280
PARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNS
280-350
SSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQM
350-420
VQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
420-458
MAAPRAGRGAGWSLRAWRALGGIRWGRRPRLTPDLRALLTSGTSDPRARVTYGTPSLWARLSVGVTEPRACLTSGTPGPRAQLTAVTPDTRTREASENSGTRSRAWLAVALGAGGAVLLLLWGGGRGPPAVLAAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE