You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
THAP12
52 kDa repressor of the inhibitor of the protein kinase

Protein Summary
Description
Upstream regulator of interferon-induced serine/threonine protein kinase R (PKR). May block the PKR-inhibitory function of DNAJC3, resulting in restoration of kinase activity and suppression of cell growth.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000260045
  • ENSP00000260045
  • ENSG00000137492

Symbol
  • DAP4
  • P52RIPK
  • PRKRIR
  • THAP0
  • DAP4
  • THAP0
  • PRKRIR
  • P52rIPK
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.37   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 145   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.37   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 145   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (64)
1 – 10 of 64
ZNF526
Tdark
Family: TF
Novelty: 7
p_int: 0.999998316
p_ni: 1.17e-7
p_wrong: 0.000001567
Data Source: BioPlex
ZNF574
Tdark
Family: TF
Novelty: 5.62962963
p_int: 0.99999163
p_ni: 0.000008371
Score: 0.708
Data Source: BioPlex,STRINGDB
CACNG5
Tdark
Family: IC
Novelty: 0.81553398
p_int: 0.999462572
p_ni: 0.000537428
Data Source: BioPlex
LHX4
Tbio
Family: TF
Novelty: 0.02376301
p_int: 0.999356819
p_ni: 0.000643181
Score: 0.518
Data Source: BioPlex,STRINGDB
XAGE1A
Tbio
Novelty: 0.04709514
p_int: 0.995212357
p_ni: 0.004787643
Data Source: BioPlex
GPR156
Tdark
Family: GPCR
Novelty: 0.46666667
p_int: 0.980572862
p_ni: 0.019427138
Data Source: BioPlex
ASB10
Tbio
Novelty: 0.12789281
p_int: 0.95311405
p_ni: 0.04688595
Score: 0.309
Data Source: BioPlex,STRINGDB
RPS14
Tbio
Novelty: 0.0062093
p_int: 0.925756026
p_ni: 0.074243974
Data Source: BioPlex
RPS16
Tbio
Novelty: 0.00413292
p_int: 0.924565827
p_ni: 0.075384297
p_wrong: 0.000049877
Data Source: BioPlex
LRRC73
Tdark
p_int: 0.894768326
p_ni: 0.105230174
p_wrong: 0.0000015
Data Source: BioPlex
Publication Statistics
PubMed Score  2.37

PubMed score by year
PubTator Score  3.12

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPNFCAAPNCTRKSTQSDLAFFRFPRDPARCQKWVENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRT
1-70
SPYRTVLRDNAIPTIFDLTSHLNNPHSRHRKRIKELSEDEIRTLKQKKIDETSEQEQKHKETNNSNAQNP
70-140
SEEEGEGQDEDILPLTLEEKENKEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRIN
140-210
SGEEVLRKRFETTAVNTLFCSKTQQRQMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLV
210-280
RFVDESHNLREEFIGFLPYEADAEILAVKFHTMITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEK
280-350
YPQAIYTLCSSCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLELDNVISVLFQNSKERGKELK
350-420
EICHSQWTGRHDAFEILVELLQALVLCLDGINSDTNIRWNNYIAGRAFVLCSAVSDFDFIVTIVVLKNVL
420-490
SFTRAFGKNLQGQTSDVFFAAGSLTAVLHSLNEVMENIEVYHEFWFEEATNLATKLDIQMKLPGKFRRAH
490-560
QGNLESQLTSESYYKETLSVPTVEHIIQELKDIFSEQHLKALKCLSLVPSVMGQLKFNTSEEHHADMYRS
560-630
DLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENG
630-700
RKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT
700-761
MPNFCAAPNCTRKSTQSDLAFFRFPRDPARCQKWVENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRTSPYRTVLRDNAIPTIFDLTSHLNNPHSRHRKRIKELSEDEIRTLKQKKIDETSEQEQKHKETNNSNAQNPSEEEGEGQDEDILPLTLEEKENKEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRINSGEEVLRKRFETTAVNTLFCSKTQQRQMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLVRFVDESHNLREEFIGFLPYEADAEILAVKFHTMITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEKYPQAIYTLCSSCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLELDNVISVLFQNSKERGKELKEICHSQWTGRHDAFEILVELLQALVLCLDGINSDTNIRWNNYIAGRAFVLCSAVSDFDFIVTIVVLKNVLSFTRAFGKNLQGQTSDVFFAAGSLTAVLHSLNEVMENIEVYHEFWFEEATNLATKLDIQMKLPGKFRRAHQGNLESQLTSESYYKETLSVPTVEHIIQELKDIFSEQHLKALKCLSLVPSVMGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT