You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
RIPK2
Receptor-interacting serine/threonine-protein kinase 2

Protein Summary
Description
Serine/threonine/tyrosine kinase that plays an essential role in modulation of innate and adaptive immune responses. Upon stimulation by bacterial peptidoglycans, NOD1 and NOD2 are activated, oligomerize and recruit RIPK2 through CARD-CARD domains. Contributes to the tyrosine phosphorylation of the guanine exchange factor ARHGEF2 through Src tyrosine kinase leading to NF-kappaB activation by NOD2. Once recruited, RIPK2 autophosphorylates and undergoes 'Lys-63'-linked polyubiquitination by E3 ubiquitin ligases XIAP, BIRC2 and BIRC3. The polyubiquitinated protein mediates the recruitment of MAP3K7/TAK1 to IKBKG/NEMO and induces 'Lys-63'-linked polyubiquitination of IKBKG/NEMO and subsequent activation of IKBKB/IKKB. In turn, NF-kappa-B is released from NF-kappa-B inhibitors and translocates into the nucleus where it activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis. Plays also a role during engagement of the T-ce ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000220751
  • ENSP00000220751
  • ENSG00000104312

Symbol
  • CARDIAK
  • RICK
  • RIP2
  • CCK
  • RICK
  • RIP2
  • CARD3
  • GIG30
  • CARDIAK
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
drug perturbation
1
virus perturbation
1
molecular function
0.99
hub protein
0.95


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 133.99   (req: < 5)
Gene RIFs: 76   (req: <= 3)
Antibodies: 608   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 133.99   (req: >= 5)
Gene RIFs: 76   (req: > 3)
Antibodies: 608   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 63
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 17
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 4
Protein Data Bank (19)
1 – 5 of 19
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (84)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 41
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Cytokine Signaling in Immune system
Reactome
Death Receptor Signalling
Reactome
Deubiquitination
Reactome
Downstream TCR signaling
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Cytokine Signaling in Immune system
Death Receptor Signalling
Deubiquitination
Downstream TCR signaling
Gene Ontology Terms (68)
Items per page:
10
1 – 10 of 10
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Protein-Protein Interactions (148)
1 – 10 of 148
PPP1R8
Tbio
Family: Enzyme
Novelty: 0.00189308
p_int: 0.998443594
p_ni: 0.001553115
p_wrong: 0.000003291
Data Source: BioPlex
TMUB1
Tbio
Novelty: 0.21276596
p_int: 0.911608524
p_ni: 0.088391469
p_wrong: 7e-9
Data Source: BioPlex
NOD1
Tchem
Novelty: 0.00337321
Score: 0.997
Data Source: Reactome,STRINGDB
BIRC3
Tchem
Novelty: 0.00226316
Score: 0.993
Data Source: STRINGDB
NOD2
Tclin
Novelty: 0.00070751
Score: 0.992
Data Source: Reactome,STRINGDB
CARD6
Tbio
Family: Enzyme
Novelty: 0.13080452
Score: 0.989
Data Source: STRINGDB
NGFR
Tclin
Novelty: 0.00089072
Score: 0.988
Data Source: Reactome,STRINGDB
TRAF6
Tbio
Novelty: 0.00159491
Score: 0.974
Data Source: STRINGDB
IKBKG
Tbio
Family: Kinase
Novelty: 0.00081998
Score: 0.972
Data Source: Reactome,STRINGDB
CYLD
Tbio
Family: Enzyme
Novelty: 0.00108371
Score: 0.969
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  133.99

PubMed score by year
PubTator Score  265.49

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSERKDVLREAEIL
1-70
HKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTP
70-140
PLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKH
140-210
DIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDER
210-280
PSFLKCLIELEPVLRTFEEITFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQ
280-350
LHENSGSPETSRSLPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIIN
350-420
PLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQL
420-490
LDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM
490-540
MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQLHENSGSPETSRSLPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIINPLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM