You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
ADCY6
Adenylate cyclase type 6

Protein Summary
Description
Catalyzes the formation of the signaling molecule cAMP downstream of G protein-coupled receptors (PubMed:17916776, PubMed:17110384). Functions in signaling cascades downstream of beta-adrenergic receptors in the heart and in vascular smooth muscle cells (PubMed:17916776). Functions in signaling cascades downstream of the vasopressin receptor in the kidney and has a role in renal water reabsorption. Functions in signaling cascades downstream of PTH1R and plays a role in regulating renal phosphate excretion. Functions in signaling cascades downstream of the VIP and SCT receptors in pancreas and contributes to the regulation of pancreatic amylase and fluid secretion (By similarity). Signaling mediates cAMP-dependent activation of protein kinase PKA. This promotes increased phosphorylation of various proteins, including AKT. Plays a role in regulating cardiac sarcoplasmic reticulum Ca(2+) uptake and storage, and is required for normal heart ventricular contractibility. May contribute to no ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000307885
  • ENSP00000311405
  • ENSG00000174233
  • ENST00000357869
  • ENSP00000350536
  • ENST00000550422
  • ENSP00000446730

Symbol
  • KIAA0422
  • AC6
  • LCCS8
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.99
molecular function
0.95
disease perturbation
0.79
pathway
0.75
small molecule perturbation
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 166.49   (req: < 5)
Gene RIFs: 22   (req: <= 3)
Antibodies: 162   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 166.49   (req: >= 5)
Gene RIFs: 22   (req: > 3)
Antibodies: 162   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 19
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
NKY80
chemical structure image
Pathways (111)
Activation of GABAB receptors (R-HSA-991365)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 36
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of GABAB receptors
Reactome
Adenylate cyclase activating pathway
Reactome
Adenylate cyclase inhibitory pathway
Reactome
Adrenaline,noradrenaline inhibits insulin secretion
Reactome
Aquaporin-mediated transport
Name
Explore in Pharos
Explore in Source
Activation of GABAB receptors
Adenylate cyclase activating pathway
Adenylate cyclase inhibitory pathway
Adrenaline,noradrenaline inhibits insulin secretion
Aquaporin-mediated transport
Protein-Protein Interactions (483)
1 – 10 of 483
LGALS8
Tchem
Novelty: 0.00746585
p_int: 0.999994706
p_ni: 0.000005294
Data Source: BioPlex
NEUROG3
Tbio
Family: TF
Novelty: 0.00367513
p_int: 0.998263373
p_ni: 0.001736627
Data Source: BioPlex
B4GAT1
Tbio
Family: Enzyme
Novelty: 0.06386176
p_int: 0.99816879
p_ni: 0.00183121
Data Source: BioPlex
YIPF3
Tbio
Novelty: 0.03141831
p_int: 0.996853287
p_ni: 0.003146701
p_wrong: 1.2e-8
Data Source: BioPlex
ANKMY2
Tdark
Novelty: 1.16129032
p_int: 0.996465395
p_ni: 0.003534427
p_wrong: 1.78e-7
Score: 0.242
Data Source: BioPlex,STRINGDB
IPPK
Tbio
Family: Enzyme
Novelty: 0.04063664
p_int: 0.991189407
p_ni: 0.008810585
p_wrong: 7e-9
Data Source: BioPlex
SYNE4
Tdark
Novelty: 0.21538462
p_int: 0.989123375
p_ni: 0.010875609
p_wrong: 0.000001016
Data Source: BioPlex
ZNRF4
Tbio
Novelty: 0.18181818
p_int: 0.987830143
p_ni: 0.012169636
p_wrong: 2.21e-7
Data Source: BioPlex
LGALS3
Tchem
Novelty: 0.00032884
p_int: 0.981675538
p_ni: 0.01832413
p_wrong: 3.32e-7
Data Source: BioPlex
NKAIN1
Tdark
Family: Enzyme
Novelty: 0.60115607
p_int: 0.96807185
p_ni: 0.031924958
p_wrong: 0.000003191
Data Source: BioPlex
Publication Statistics
PubMed Score  166.49

PubMed score by year
PubTator Score  52.59

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSWFSGLLVPKVDERKTAWGERNGQKRSRRRGTRAGGFCTPRYMSCLRDAEPPSPTPAGPPRCPWQDDAF
1-70
IRRGGPGKGKELGLRAVALGFEDTEVTTTAGGTAEVAPDAVPRSGRSCWRRLVQVFQSKQFRSAKLERLY
70-140
QRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAYVALLACAAALFVGLMVVCNRHSFRQDSMWV
140-210
VSYVVLGILAAVQVGGALAADPRSPSAGLWCPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNR
210-280
GDAFLWKQLGANVLLFLCTNVIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHV
280-350
AMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHC
350-420
LRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKW
420-490
QFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLKEQHIETFLILGASQKRK
490-560
EEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFRQMGIDDSSKDNRGTQDALNPEDEVDEFLSR
560-630
AIDARSIDQLRKDHVRRFLLTFQREDLEKKYSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSTLMLGI
630-700
YASIFLLLLITVLICAVYSCGSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIR
700-770
SCAARMLNLTPADITACHLQQLNYSLGLDAPLCEGTMPTCSFPEYFIGNMLLSLLASSVFLHISSIGKLA
770-840
MIFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPVILLVFALALY
840-910
LHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAV
910-980
MFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEERFRQLEKIKTIGSTYMAASGLNASTYDQ
980-1050
VGRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDST
1050-1120
GVPDRIQVTTDLYQVLAAKGYQLECRGVVKVKGKGEMTTYFLNGGPSS
1120-1168
MSWFSGLLVPKVDERKTAWGERNGQKRSRRRGTRAGGFCTPRYMSCLRDAEPPSPTPAGPPRCPWQDDAFIRRGGPGKGKELGLRAVALGFEDTEVTTTAGGTAEVAPDAVPRSGRSCWRRLVQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAYVALLACAAALFVGLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPRSPSAGLWCPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRGDAFLWKQLGANVLLFLCTNVIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFRQMGIDDSSKDNRGTQDALNPEDEVDEFLSRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSTLMLGIYASIFLLLLITVLICAVYSCGSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRSCAARMLNLTPADITACHLQQLNYSLGLDAPLCEGTMPTCSFPEYFIGNMLLSLLASSVFLHISSIGKLAMIFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPVILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQLECRGVVKVKGKGEMTTYFLNGGPSS