You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RRP8
Ribosomal RNA-processing protein 8

Protein Summary
Description
Essential component of the eNoSC (energy-dependent nucleolar silencing) complex, a complex that mediates silencing of rDNA in response to intracellular energy status and acts by recruiting histone-modifying enzymes. The eNoSC complex is able to sense the energy status of cell: upon glucose starvation, elevation of NAD(+)/NADP(+) ratio activates SIRT1, leading to histone H3 deacetylation followed by dimethylation of H3 at 'Lys-9' (H3K9me2) by SUV39H1 and the formation of silent chromatin in the rDNA locus. In the complex, RRP8 binds to H3K9me2 and probably acts as a methyltransferase. Its substrates are however unknown.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000254605
  • ENSP00000254605
  • ENSG00000132275

Symbol
  • KIAA0409
  • NML
  • NML
  • KIAA0409
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug perturbation
0.87
biological process
0.78
transcription factor binding site profile
0.76
cellular component
0.65
tissue sample
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 211.06   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 134   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 211.06   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 134   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
Epigenetic regulation of gene expression (R-HSA-212165)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Epigenetic regulation of gene expression
Reactome
Gene expression (Transcription)
Reactome
Negative epigenetic regulation of rRNA expression
Reactome
SIRT1 negatively regulates rRNA expression
Name
Explore in Pharos
Explore in Source
Epigenetic regulation of gene expression
Gene expression (Transcription)
Negative epigenetic regulation of rRNA expression
SIRT1 negatively regulates rRNA expression
Protein-Protein Interactions (316)
1 – 10 of 316
DGCR8
Tbio
Novelty: 0.00319395
p_int: 0.999963337
p_ni: 0.000036663
Score: 0.219
Data Source: BioPlex,STRINGDB
ZC3HAV1
Tbio
Novelty: 0.01794897
p_int: 0.999423996
p_ni: 0.000576004
Score: 0.292
Data Source: BioPlex,STRINGDB
CENPV
Tbio
Novelty: 0.00220485
p_int: 0.999333809
p_ni: 0.000666179
p_wrong: 1.2e-8
Score: 0.245
Data Source: BioPlex,STRINGDB
HIST1H1A
Tbio
Novelty: 0.00658293
p_int: 0.998811099
p_ni: 0.001188901
Data Source: BioPlex
SPTY2D1
Tbio
Novelty: 0.20178739
p_int: 0.998780662
p_ni: 0.001219338
Score: 0.517
Data Source: BioPlex,STRINGDB
ZNF800
Tdark
Family: TF
Novelty: 4
p_int: 0.998692513
p_ni: 0.001307467
p_wrong: 2e-8
Score: 0.514
Data Source: BioPlex,STRINGDB
PDCD11
Tbio
Novelty: 0.02896416
p_int: 0.996695052
p_ni: 0.003304948
Score: 0.911
Data Source: BioPlex,STRINGDB
PUM3
Tbio
Novelty: 0.01145585
p_int: 0.996159257
p_ni: 0.003840743
Score: 0.933
Data Source: BioPlex,STRINGDB
DDX54
Tbio
Family: Enzyme
Novelty: 0.10631117
p_int: 0.99612773
p_ni: 0.00387227
Score: 0.922
Data Source: BioPlex,STRINGDB
RPL30
Tbio
Novelty: 0.0256669
p_int: 0.995970109
p_ni: 0.004029891
Score: 0.323
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  211.06

PubMed score by year
PubTator Score  8.43

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFEEPEWAEAAPVAAGLGPVISRPPPAASSQNKGSKRRQLLATLRALEAASLSQHPPSLCISDSEEEEEE
1-70
RKKKCPKKASFASASAEVGKKGKKKCQKQGPPCSDSEEEVERKKKCHKQALVGSDSAEDEKRKRKCQKHA
70-140
PINSAQHLDNVDQTGPKAWKGSTTNDPPKQSPGSTSPKPPHTLSRKQWRNRQKNKRRCKNKFQPPQVPDQ
140-210
APAEAPTEKTEVSPVPRTDSHEARAGALRARMAQRLDGARFRYLNEQLYSGPSSAAQRLFQEDPEAFLLY
210-280
HRGFQSQVKKWPLQPVDRIARDLRQRPASLVVADFGCGDCRLASSIRNPVHCFDLASLDPRVTVCDMAQV
280-350
PLEDESVDVAVFCLSLMGTNIRDFLEEANRVLKPGGLLKVAEVSSRFEDVRTFLRAVTKLGFKIVSKDLT
350-420
NSHFFLFDFQKTGPPLVGPKAQLSGLQLQPCLYKRR
420-456
MFEEPEWAEAAPVAAGLGPVISRPPPAASSQNKGSKRRQLLATLRALEAASLSQHPPSLCISDSEEEEEERKKKCPKKASFASASAEVGKKGKKKCQKQGPPCSDSEEEVERKKKCHKQALVGSDSAEDEKRKRKCQKHAPINSAQHLDNVDQTGPKAWKGSTTNDPPKQSPGSTSPKPPHTLSRKQWRNRQKNKRRCKNKFQPPQVPDQAPAEAPTEKTEVSPVPRTDSHEARAGALRARMAQRLDGARFRYLNEQLYSGPSSAAQRLFQEDPEAFLLYHRGFQSQVKKWPLQPVDRIARDLRQRPASLVVADFGCGDCRLASSIRNPVHCFDLASLDPRVTVCDMAQVPLEDESVDVAVFCLSLMGTNIRDFLEEANRVLKPGGLLKVAEVSSRFEDVRTFLRAVTKLGFKIVSKDLTNSHFFLFDFQKTGPPLVGPKAQLSGLQLQPCLYKRR