You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
FFAR2
Free fatty acid receptor 2

Protein Summary
Description
G protein-coupled receptor that is activated by a major product of dietary fiber digestion, the short chain fatty acids (SCFAs), and that plays a role in the regulation of whole-body energy homeostasis and in intestinal immunity. In omnivorous mammals, the short chain fatty acids acetate, propionate and butyrate are produced primarily by the gut microbiome that metabolizes dietary fibers. SCFAs serve as a source of energy but also act as signaling molecules. That G protein-coupled receptor is probably coupled to the pertussis toxin-sensitive, G(i/o)-alpha family of G proteins but also to the Gq family (PubMed:12496283, PubMed:12711604, PubMed:23589301). Its activation results in the formation of inositol 1,4,5-trisphosphate, the mobilization of intracellular calcium, the phosphorylation of the MAPK3/ERK1 and MAPK1/ERK2 kinases and the inhibition of intracellular cAMP accumulation. May play a role in glucose homeostasis by regulating the secretion of GLP-1, in response to short-chain fa ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000246549
  • ENSP00000246549
  • ENSG00000126262
  • ENST00000599180
  • ENSP00000473159

Symbol
  • FFA2
  • GPCR43
  • GPR43
  • FFA2R
  • GPR43
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
phenotype
0.85
biological process
0.83
cell type or tissue
0.63
tissue sample
0.54
ligand (chemical)
0.51


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 171.31   (req: < 5)
Gene RIFs: 32   (req: <= 3)
Antibodies: 298   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 171.31   (req: >= 5)
Gene RIFs: 32   (req: > 3)
Antibodies: 298   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 7
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (10)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
Free fatty acid receptors
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
Free fatty acid receptors
G alpha (q) signalling events
GPCR downstream signalling
GPCR ligand binding
Gene Ontology Terms (19)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (198)
1 – 10 of 198
FFAR4
Tchem
Family: GPCR
Novelty: 0.00603151
Score: 0.981
Data Source: STRINGDB
GPRC6A
Tchem
Family: GPCR
Novelty: 0.02008511
Score: 0.97
Data Source: STRINGDB
GCG
Tchem
Novelty: 0.00005614
Score: 0.965
Data Source: STRINGDB
CCK
Tbio
Novelty: 0.00013779
Score: 0.945
Data Source: STRINGDB
CASR
Tclin
Family: GPCR
Novelty: 0.00066875
Score: 0.944
Data Source: STRINGDB
GNAQ
Tbio
Novelty: 0.00176666
Score: 0.935
Data Source: STRINGDB
FPR2
Tchem
Family: GPCR
Novelty: 0.00286277
Score: 0.932
Data Source: STRINGDB
CCKAR
Tclin
Family: GPCR
Novelty: 0.00159237
Score: 0.923
Data Source: STRINGDB
FFAR1
Tchem
Family: GPCR
Novelty: 0.00307613
Score: 0.92
Data Source: STRINGDB
GRK5
Tchem
Family: Kinase
Novelty: 0.01219315
Score: 0.916
Data Source: STRINGDB
Publication Statistics
PubMed Score  171.31

PubMed score by year
PubTator Score  75.04

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAA
1-70
SNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGH
70-140
CTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQP
140-210
LVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVV
210-280
RRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
280-330
MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE