You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
ABCC4
Multidrug resistance-associated protein 4

Protein Summary
Description
May be an organic anion pump relevant to cellular detoxification. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This family member plays a role in cellular detoxification as a pump for its substrate, organic anions. It may also function in prostaglandin-mediated cAMP signaling in ciliogenesis. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000376887
  • ENSP00000366084
  • ENSG00000125257
  • ENST00000536256
  • ENSP00000442024
  • ENST00000629385
  • ENSP00000487081
  • ENST00000645237
  • ENSP00000494609
  • ENST00000646439
  • ENSP00000494751

Symbol
  • MRP4
  • MRP4
  • MOATB
  • MOAT-B
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug
0.99
molecular function
0.99
chemical
0.96
trait
0.93
transcription factor binding site profile
0.91


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 366.06   (req: < 5)
Gene RIFs: 135   (req: <= 3)
Antibodies: 432   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 366.06   (req: >= 5)
Gene RIFs: 135   (req: > 3)
Antibodies: 432   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
estradiol disulfate
chemical structure image
Pathways (19)
ABC-family proteins mediated transport (R-HSA-382556)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
ABC-family proteins mediated transport
Reactome
Hemostasis
Reactome
Platelet activation, signaling and aggregation
Reactome
Platelet degranulation
Reactome
Response to elevated platelet cytosolic Ca2+
Name
Explore in Pharos
Explore in Source
ABC-family proteins mediated transport
Hemostasis
Platelet activation, signaling and aggregation
Platelet degranulation
Response to elevated platelet cytosolic Ca2+
Gene Ontology Terms (18)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Non-traceable Author Statement (NAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (97)
1 – 10 of 97
PDZK1P1
Tdark
p_int: 0.999999912
p_ni: 8.1e-8
p_wrong: 8e-9
Data Source: BioPlex
LGALS8
Tchem
Novelty: 0.00746585
p_int: 0.999997166
p_ni: 0.000002834
Data Source: BioPlex
LRTM2
Tdark
Novelty: 2.4
p_int: 0.999994658
p_ni: 0.000005342
Data Source: BioPlex
LGALS3
Tchem
Novelty: 0.00032884
p_int: 0.999859477
p_ni: 0.000140523
Score: 0.523
Data Source: BioPlex,STRINGDB
NAT8B
Tbio
Family: Enzyme
p_int: 0.986811747
p_ni: 0.013142282
p_wrong: 0.000045971
Data Source: BioPlex
ATP2B2
Tbio
Family: Transporter
Novelty: 0.00724828
p_int: 0.983918302
p_ni: 0.016081689
p_wrong: 9e-9
Score: 0.18
Data Source: BioPlex,STRINGDB
RXFP1
Tchem
Family: GPCR
Novelty: 0.00590091
p_int: 0.983863014
p_ni: 0.016129709
p_wrong: 0.000007277
Data Source: BioPlex
SLC4A8
Tbio
Family: Transporter
Novelty: 0.00405991
p_int: 0.983021239
p_ni: 0.016978741
p_wrong: 2e-8
Score: 0.234
Data Source: BioPlex,STRINGDB
REEP5
Tbio
Novelty: 0.00356586
p_int: 0.981567284
p_ni: 0.018432689
p_wrong: 2.8e-8
Score: 0.185
Data Source: BioPlex,STRINGDB
TMEM128
Tdark
p_int: 0.967636288
p_ni: 0.032363709
p_wrong: 3e-9
Score: 0.527
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  366.06

PubMed score by year
PubTator Score  276.15

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEELQGFWDKEVLR
1-70
AENDAQKPSLTRAIIKCYWKSYLVLGIFTLIEESAKVIQPIFLGKIINYFENYDPMDSVALNTAYAYATV
70-140
LTFCTLILAILHHLYFYHVQCAGMRLRVAMCHMIYRKALRLSNMAMGKTTTGQIVNLLSNDVNKFDQVTV
140-210
FLHFLWAGPLQAIAVTALLWMEIGISCLAGMAVLIILLPLQSCFGKLFSSLRSKTATFTDARIRTMNEVI
210-280
TGIRIIKMYAWEKSFSNLITNLRKKEISKILRSSCLRGMNLASFFSASKIIVFVTFTTYVLLGSVITASR
280-350
VFVAVTLYGAVRLTVTLFFPSAIERVSEAIVSIRRIQTFLLLDEISQRNRQLPSDGKKMVHVQDFTAFWD
350-420
KASETPTLQGLSFTVRPGELLAVVGPVGAGKSSLLSAVLGELAPSHGLVSVHGRIAYVSQQPWVFSGTLR
420-490
SNILFGKKYEKERYEKVIKACALKKDLQLLEDGDLTVIGDRGTTLSGGQKARVNLARAVYQDADIYLLDD
490-560
PLSAVDAEVSRHLFELCICQILHEKITILVTHQLQYLKAASQILILKDGKMVQKGTYTEFLKSGIDFGSL
560-630
LKKDNEESEQPPVPGTPTLRNRTFSESSVWSQQSSRPSLKDGALESQDTENVPVTLSEENRSEGKVGFQA
630-700
YKNYFRAGAHWIVFIFLILLNTAAQVAYVLQDWWLSYWANKQSMLNVTVNGGGNVTEKLDLNWYLGIYSG
700-770
LTVATVLFGIARSLLVFYVLVNSSQTLHNKMFESILKAPVLFFDRNPIGRILNRFSKDIGHLDDLLPLTF
770-840
LDFIQTLLQVVGVVSVAVAVIPWIAIPLVPLGIIFIFLRRYFLETSRDVKRLESTTRSPVFSHLSSSLQG
840-910
LWTIRAYKAEERCQELFDAHQDLHSEAWFLFLTTSRWFAVRLDAICAMFVIIVAFGSLILAKTLDAGQVG
910-980
LALSYALTLMGMFQWCVRQSAEVENMMISVERVIEYTDLEKEAPWEYQKRPPPAWPHEGVIIFDNVNFMY
980-1050
SPGGPLVLKHLTALIKSQEKVGIVGRTGAGKSSLISALFRLSEPEGKIWIDKILTTEIGLHDLRKKMSII
1050-1120
PQEPVLFTGTMRKNLDPFNEHTDEELWNALQEVQLKETIEDLPGKMDTELAESGSNFSVGQRQLVCLARA
1120-1190
ILRKNQILIIDEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYV
1190-1260
LLQNKESLFYKMVQQLGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPSTLTIFETAL
1260-1325
MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEELQGFWDKEVLRAENDAQKPSLTRAIIKCYWKSYLVLGIFTLIEESAKVIQPIFLGKIINYFENYDPMDSVALNTAYAYATVLTFCTLILAILHHLYFYHVQCAGMRLRVAMCHMIYRKALRLSNMAMGKTTTGQIVNLLSNDVNKFDQVTVFLHFLWAGPLQAIAVTALLWMEIGISCLAGMAVLIILLPLQSCFGKLFSSLRSKTATFTDARIRTMNEVITGIRIIKMYAWEKSFSNLITNLRKKEISKILRSSCLRGMNLASFFSASKIIVFVTFTTYVLLGSVITASRVFVAVTLYGAVRLTVTLFFPSAIERVSEAIVSIRRIQTFLLLDEISQRNRQLPSDGKKMVHVQDFTAFWDKASETPTLQGLSFTVRPGELLAVVGPVGAGKSSLLSAVLGELAPSHGLVSVHGRIAYVSQQPWVFSGTLRSNILFGKKYEKERYEKVIKACALKKDLQLLEDGDLTVIGDRGTTLSGGQKARVNLARAVYQDADIYLLDDPLSAVDAEVSRHLFELCICQILHEKITILVTHQLQYLKAASQILILKDGKMVQKGTYTEFLKSGIDFGSLLKKDNEESEQPPVPGTPTLRNRTFSESSVWSQQSSRPSLKDGALESQDTENVPVTLSEENRSEGKVGFQAYKNYFRAGAHWIVFIFLILLNTAAQVAYVLQDWWLSYWANKQSMLNVTVNGGGNVTEKLDLNWYLGIYSGLTVATVLFGIARSLLVFYVLVNSSQTLHNKMFESILKAPVLFFDRNPIGRILNRFSKDIGHLDDLLPLTFLDFIQTLLQVVGVVSVAVAVIPWIAIPLVPLGIIFIFLRRYFLETSRDVKRLESTTRSPVFSHLSSSLQGLWTIRAYKAEERCQELFDAHQDLHSEAWFLFLTTSRWFAVRLDAICAMFVIIVAFGSLILAKTLDAGQVGLALSYALTLMGMFQWCVRQSAEVENMMISVERVIEYTDLEKEAPWEYQKRPPPAWPHEGVIIFDNVNFMYSPGGPLVLKHLTALIKSQEKVGIVGRTGAGKSSLISALFRLSEPEGKIWIDKILTTEIGLHDLRKKMSIIPQEPVLFTGTMRKNLDPFNEHTDEELWNALQEVQLKETIEDLPGKMDTELAESGSNFSVGQRQLVCLARAILRKNQILIIDEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYVLLQNKESLFYKMVQQLGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPSTLTIFETAL