You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SLC31A1
High affinity copper uptake protein 1

Protein Summary
Description
High-affinity, saturable copper transporter involved in dietary copper uptake. The protein encoded by this gene is a high-affinity copper transporter found in the cell membrane. The encoded protein functions as a homotrimer to effect the uptake of dietary copper. [provided by RefSeq, Aug 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000374212
  • ENSP00000363329
  • ENSG00000136868

Symbol
  • COPT1
  • CTR1
  • CTR1
  • COPT1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.93
histone modification site profile
0.89
transcription factor perturbation
0.88
cell type or tissue
0.79
transcription factor
0.7


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 122.07   (req: < 5)
Gene RIFs: 61   (req: <= 3)
Antibodies: 220   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 122.07   (req: >= 5)
Gene RIFs: 61   (req: > 3)
Antibodies: 220   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (7)
Metal ion SLC transporters (R-HSA-425410)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metal ion SLC transporters
Reactome
SLC-mediated transmembrane transport
Reactome
Transport of bile salts and organic acids, metal ions and amine compounds
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
Metal ion SLC transporters
SLC-mediated transmembrane transport
Transport of bile salts and organic acids, metal ions and amine compounds
Transport of small molecules
Protein-Protein Interactions (76)
1 – 10 of 76
STX7
Tbio
Novelty: 0.052457
p_int: 0.964121765
p_ni: 0.03587817
p_wrong: 6.4e-8
Score: 0.151
Data Source: BioPlex,STRINGDB
PLXDC2
Tbio
Novelty: 0.11383622
p_int: 0.951579816
p_ni: 0.048420184
Score: 0.177
Data Source: BioPlex,STRINGDB
CD70
Tbio
Novelty: 0.00552433
p_int: 0.949801851
p_ni: 0.050198004
p_wrong: 1.45e-7
Data Source: BioPlex
ERBB3
Tclin
Family: Kinase
Novelty: 0.00097581
p_int: 0.932496876
p_ni: 0.067502664
p_wrong: 4.6e-7
Score: 0.234
Data Source: BioPlex,STRINGDB
TMPRSS11B
Tdark
Family: Enzyme
Novelty: 1.71428571
p_int: 0.896551143
p_ni: 0.103448731
p_wrong: 1.27e-7
Data Source: BioPlex
NCR3LG1
Tbio
Novelty: 0.03574232
p_int: 0.894228694
p_ni: 0.105771306
Score: 0.196
Data Source: BioPlex,STRINGDB
LGALS8
Tchem
Novelty: 0.00746585
p_int: 0.882102673
p_ni: 0.117897008
p_wrong: 3.2e-7
Data Source: BioPlex
CLEC2B
Tbio
Novelty: 0.01865616
p_int: 0.753779207
p_ni: 0.024224849
p_wrong: 0.221995943
Data Source: BioPlex
ATOX1
Tbio
Novelty: 0.00696603
Score: 0.876
Data Source: STRINGDB
ATP7A
Tbio
Family: Enzyme
Novelty: 0.00077444
Score: 0.865
Data Source: STRINGDB
Publication Statistics
PubMed Score  122.07

PubMed score by year
PubTator Score  198.36

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAGEMA
1-70
GAFVAVFLLAMFYEGLKIARESLLRKSQVSIRYNSMPVPGPNGTILMETHKTVGQQMLSFPHLLQTVLHI
70-140
IQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH
140-190
MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAGEMAGAFVAVFLLAMFYEGLKIARESLLRKSQVSIRYNSMPVPGPNGTILMETHKTVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH