Protein Classes
Protein Summary
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4), and some other non-histone substrates. Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Participates in the BCL6 transcriptional repressor activity by deacetylating the H3 'Lys-27' (H3K27) on enhancer elements, antagonizing EP300 acetyltransferase activity and repressing proximal gene expression. Probably participates in the regulation of transcription through its binding to the zinc-finger transcription factor YY1; increases YY1 repression activity. Required to repress transcription of the POU1F1 transcription factor. Acts as a molecular chaperone for shuttling phosphorylated NR2C1 to PML bodies for sumoylation (PubMed:21444723, PubMed:23911289). Contributes, together with XB ...more
- ENST00000305264
- ENSP00000302967
- ENSG00000171720
- HD3
- RPD3
- KDAC3
- RPD3-2
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
|---|---|---|---|
biological process | 1 | ||
hub protein | 1 | ||
molecular function | 0.98 | ||
histone modification site profile | 0.87 | ||
cell type or tissue | 0.8 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 165.84 (req: < 5)
Gene RIFs: 161 (req: <= 3)
Antibodies: 845 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 165.84 (req: >= 5)
Gene RIFs: 161 (req: > 3)
Antibodies: 845 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 28
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligands: 805
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drugs: 5
Approved Drugs (5)
1 – 5 of 5
Active Ligands (805)
1 – 10 of 805
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id | Ligand | Method | Resolution (Å) | M.W. (kDa) | Pub Year | Title |
|---|
PDB Structure Id | M.W. | Resolution | Pub Year |
|---|
Pathways (65)
Reactome (50)
KEGG (3)
PathwayCommons (7)
WikiPathways (5)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 50
Data Source | Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|---|
Reactome | Activation of HOX genes during differentiation | ||||
Reactome | Activation of anterior HOX genes in hindbrain development during early embryogenesis | ||||
Reactome | Association of TriC/CCT with target proteins during biosynthesis | ||||
Reactome | Chaperonin-mediated protein folding | ||||
Reactome | Chromatin modifying enzymes | ||||
Name | Explore in Pharos | Explore in Source | ||
|---|---|---|---|---|
Activation of HOX genes during differentiation | ||||
Activation of anterior HOX genes in hindbrain development during early embryogenesis | ||||
Association of TriC/CCT with target proteins during biosynthesis | ||||
Chaperonin-mediated protein folding | ||||
Chromatin modifying enzymes | ||||
Gene Ontology Terms (37)
Functions (10)
Components (9)
Processes (18)
Items per page:
10
1 – 10 of 10
GO Term | Evidence | Assigned by | ||
|---|---|---|---|---|
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Direct Assay (IDA) | UniProtKB | |||
Inferred from Physical Interaction (IPI) | UniProtKB | |||
Inferred from Physical Interaction (IPI) | UniProtKB | |||
Inferred from Physical Interaction (IPI) | UniProtKB | |||
Inferred from Physical Interaction (IPI) | UniProtKB | |||
Inferred from Physical Interaction (IPI) | UniProtKB | |||
Inferred from Mutant Phenotype (IMP) | UniProtKB | |||
Inferred from Electronic Annotation (IEA) | UniProtKB-EC | |||
Protein-Protein Interactions (468)
1 – 10 of 468
GPS2
Novelty: 0.01793637
p_int: 0.999990105
p_ni: 0.000009895
Score: 0.969
Data Source: BioPlex,Reactome,STRINGDB
TBL1Y
p_int: 0.999980819
p_ni: 0.000019181
Data Source: BioPlex
ZSCAN5A
Family: TF
Novelty: 4
p_int: 0.983696316
p_ni: 0.016303684
Score: 0.244
Data Source: BioPlex,STRINGDB
HNRNPLL
Novelty: 0.0389045
p_int: 0.978655801
p_ni: 0.021344089
p_wrong: 1.1e-7
Score: 0.229
Data Source: BioPlex,STRINGDB
CELA1
Family: Enzyme
Novelty: 0.00355186
p_int: 0.944434767
p_ni: 0.055550934
p_wrong: 0.000014299
Score: 0.169
Data Source: BioPlex,STRINGDB
DGKG
Family: Enzyme
Novelty: 0.04706767
p_int: 0.942114844
p_ni: 0.057885155
p_wrong: 1e-9
Data Source: BioPlex
CARD8
Family: Enzyme
Novelty: 0.00962965
p_int: 0.940935638
p_ni: 0.057414604
p_wrong: 0.001649758
Data Source: BioPlex
CCT3
Novelty: 0.00555442
p_int: 0.923828025
p_ni: 0.076170401
p_wrong: 0.000001574
Score: 0.918
Data Source: BioPlex,STRINGDB
CDK2AP1
Family: Enzyme
Novelty: 0.00794768
p_int: 0.891059083
p_ni: 0.10893527
p_wrong: 0.000005647
Data Source: BioPlex
RFPL4B
p_int: 0.885292341
p_ni: 0.114707659
Score: 0.16
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score 165.84
PubMed score by year
PubTator Score 430.68
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFL
1-70
QRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFE
70-140
ASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVG
140-210
AESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECV
210-280
EYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQN
280-350
SRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
350-420
DKESDVEI
420-428
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Find similar targets by: