You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
ALOX15B
Arachidonate 15-lipoxygenase B

Protein Summary
Description
Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids generating a spectrum of bioactive lipid mediators. Converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid/(15S)-HPETE. Also acts on linoleic acid to produce 13-hydroxyoctadecadienoic acid/13-HPODE. Has no detectable 8S-lipoxygenase activity but reacts with (8S)-HPETE to produce (8S,15S)-diHPETE. May regulate progression through the cell cycle and cell proliferation. May also regulate cytokine secretion by macrophages and therefore play a role in the immune response. May also regulate macrophage differentiation into proatherogenic foam cells. This gene encodes a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The encoded protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effect ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000380173
  • ENSP00000369520
  • ENSG00000179593
  • ENST00000380183
  • ENSP00000369530
  • ENST00000573359
  • ENSP00000460332

Symbol
  • 15-LOX-2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.92
biological process
0.83
gene perturbation
0.76
cellular component
0.72
tissue sample
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 56.89   (req: < 5)
Gene RIFs: 33   (req: <= 3)
Antibodies: 243   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 56.89   (req: >= 5)
Gene RIFs: 33   (req: > 3)
Antibodies: 243   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 22
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 5
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (12)
Arachidonic acid metabolism (R-HSA-2142753)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Arachidonic acid metabolism
Reactome
Fatty acid metabolism
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Synthesis of 15-eicosatetraenoic acid derivatives
Name
Explore in Pharos
Explore in Source
Arachidonic acid metabolism
Fatty acid metabolism
Metabolism
Metabolism of lipids
Synthesis of 15-eicosatetraenoic acid derivatives
Gene Ontology Terms (30)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (64)
1 – 10 of 64
KBTBD2
Tdark
Novelty: 0.82758621
p_int: 0.999999544
p_ni: 1.6e-8
p_wrong: 4.4e-7
Score: 0.416
Data Source: BioPlex,STRINGDB
RPH3A
Tbio
Family: Epigenetic
Novelty: 0.01664949
p_int: 0.998054085
p_ni: 0.001924213
p_wrong: 0.000021702
Score: 0.209
Data Source: BioPlex,STRINGDB
NPPA
Tchem
Novelty: 0.00054421
p_int: 0.993167821
p_ni: 0.006352116
p_wrong: 0.000480064
Score: 0.179
Data Source: BioPlex,STRINGDB
TAF5L
Tbio
Family: Enzyme
Novelty: 0.54405952
p_int: 0.966599028
p_ni: 0.033294986
p_wrong: 0.000105986
Score: 0.188
Data Source: BioPlex,STRINGDB
KIF3A
Tbio
Novelty: 0.00780024
p_int: 0.958543674
p_ni: 0.041456239
p_wrong: 8.8e-8
Score: 0.186
Data Source: BioPlex,STRINGDB
PTGS1
Tclin
Family: Enzyme
Novelty: 0.00056169
Score: 0.946
Data Source: STRINGDB
PTGS2
Tclin
Family: Enzyme
Novelty: 0.00008134
Score: 0.942
Data Source: STRINGDB
CYP4F2
Tchem
Family: Enzyme
Novelty: 0.00647783
Score: 0.918
Data Source: STRINGDB
CYP4F3
Tbio
Family: Enzyme
Novelty: 0.01901093
Score: 0.917
Data Source: STRINGDB
CYP2C8
Tchem
Novelty: 0.00265032
Score: 0.913
Data Source: STRINGDB
Publication Statistics
PubMed Score  56.89

PubMed score by year
PubTator Score  60.75

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVH
1-70
KAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQEGTAKVSWADHHPVLQQQRQE
70-140
ELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAKNANFYLQAGSAFAEMKIKGLLDRKGLWRSL
140-210
NEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQA
210-280
ELEKGSLFLVDHGILSGIQTNVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDK
280-350
WDWLLAKTWVRNAEFSFHEALTHLLHSHLLPEVFTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELL
350-420
IVPGQVVDRSTGIGIEGFSELIQRNMKQLNYSLLCLPEDIRTRGVEDIPGYYYRDDGMQIWGAVERFVSE
420-490
IIGIYYPSDESVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQYVTMVIFTCSAKHAAVSAGQ
490-560
FDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTE
560-630
EAPRRSIATFQSRLAQISRGIQERNQGLVLPYTYLDPPLIENSVSI
630-676
MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQEGTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAKNANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQTNVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKWDWLLAKTWVRNAEFSFHEALTHLLHSHLLPEVFTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELLIVPGQVVDRSTGIGIEGFSELIQRNMKQLNYSLLCLPEDIRTRGVEDIPGYYYRDDGMQIWGAVERFVSEIIGIYYPSDESVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQYVTMVIFTCSAKHAAVSAGQFDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPRRSIATFQSRLAQISRGIQERNQGLVLPYTYLDPPLIENSVSI