You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
SPTLC1
Serine palmitoyltransferase 1

Protein Summary
Description
Serine palmitoyltransferase (SPT). The heterodimer formed with SPTLC2 or SPTLC3 constitutes the catalytic core. The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference. The SPTLC1-SPTLC2-SPTSSA complex shows a strong preference for C16-CoA substrate, while the SPTLC1-SPTLC3-SPTSSA isozyme uses both C14-CoA and C16-CoA as substrates, with a slight preference for C14-CoA. The SPTLC1-SPTLC2-SPTSSB complex shows a strong preference for C18-CoA substrate, while the SPTLC1-SPTLC3-SPTSSB isozyme displays an ability to use a broader range of acyl-CoAs, without apparent preference. This gene encodes a member of the class-II pyridoxal-phosphate-dependent aminotransferase family. The encoded protein is the long chain base subunit 1 of serine palmitoyltransferase. Serine palmitoyltransferase converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate and is the key enzyme in sphingolipid biosynthesis. Mutations in this gene were ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000262554
  • ENSP00000262554
  • ENSG00000090054
  • ENST00000337841
  • ENSP00000337635

Symbol
  • LCB1
  • HSN1
  • LBC1
  • LCB1
  • SPT1
  • SPTI
  • HSAN1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.95
interacting protein
0.9
transcription factor perturbation
0.84
histone modification site profile
0.8
transcription factor
0.72


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 122.63   (req: < 5)
Gene RIFs: 25   (req: <= 3)
Antibodies: 354   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 122.63   (req: >= 5)
Gene RIFs: 25   (req: > 3)
Antibodies: 354   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 2
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (11)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Sphingolipid de novo biosynthesis
Reactome
Sphingolipid metabolism
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of lipids
Sphingolipid de novo biosynthesis
Sphingolipid metabolism
Protein-Protein Interactions (114)
1 – 10 of 114
SPTSSA
Tbio
Family: Enzyme
Novelty: 0.35928144
Score: 0.995
Data Source: Reactome,STRINGDB
SPTSSB
Tdark
Family: Enzyme
Novelty: 0.02684357
Score: 0.993
Data Source: Reactome,STRINGDB
SPTLC2
Tchem
Family: Enzyme
Novelty: 0.01896868
Score: 0.991
Data Source: Reactome,STRINGDB
SPTLC3
Tbio
Family: Enzyme
Novelty: 0.06354709
Score: 0.99
Data Source: Reactome,STRINGDB
ORMDL3
Tbio
Novelty: 0.01336886
Score: 0.982
Data Source: STRINGDB
KDSR
Tbio
Family: Enzyme
Novelty: 0.05802174
Score: 0.979
Data Source: STRINGDB
ORMDL1
Tbio
Novelty: 0.46248621
Score: 0.92
Data Source: STRINGDB
GOLGA7
Tbio
Novelty: 0.42056075
Score: 0.902
Data Source: STRINGDB
ZDHHC9
Tbio
Family: Enzyme
Novelty: 0.07515658
Score: 0.9
Data Source: STRINGDB
ORMDL2
Tdark
Novelty: 1.15710653
Score: 0.876
Data Source: STRINGDB
Publication Statistics
PubMed Score  122.63

PubMed score by year
PubTator Score  97.41

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEELIEEWQPEPLV
1-70
PPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYG
70-140
TFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDRAACFAIQKGLQASRSDIKLFK
140-210
HNDMADLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFG
210-280
VLGEHGRGVTEHYGINIDDIDLISANMENALASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAI
280-350
EALNIMEENPGIFAVLKEKCGQIHKALQGISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCM
350-420
NRSIALTQARYLEKEEKCLPPPSIRVVVTVEQTEEELERAASTIKEVAQAVLL
420-473
MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDRAACFAIQKGLQASRSDIKLFKHNDMADLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLISANMENALASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCGQIHKALQGISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVEQTEEELERAASTIKEVAQAVLL