You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
RTL8C
CAAX box protein 1

Protein Summary
Uniprot Accession IDs
Gene Name
Symbol
  • CXX1
  • FAM127A
  • MAR8
  • MAR8C
  • MART8
  • CXX1
  • Mar8
  • MAR8C
  • Mart8
  • SIRH5
  • MART8C
  • FAM127A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.51   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.51   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (1)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (16)
1 – 10 of 16
HLA-DRA
Tbio
Novelty: 0.00705028
p_int: 0.962236705
p_ni: 0.037704764
p_wrong: 0.000058531
Data Source: BioPlex
TACR3
Tchem
Family: GPCR
Novelty: 0.00322406
p_int: 0.958338142
p_ni: 0.040848339
p_wrong: 0.000813519
Data Source: BioPlex
RLN1
Tbio
Novelty: 0.05712331
p_int: 0.950981132
p_ni: 0.046534702
p_wrong: 0.002484167
Data Source: BioPlex
MGARP
Tbio
Novelty: 0.03593252
p_int: 0.896460253
p_ni: 0.031113014
p_wrong: 0.072426733
Data Source: BioPlex
TMEM106A
Tdark
Novelty: 0.49469965
p_int: 0.760066202
p_ni: 0.239365367
p_wrong: 0.000568431
Data Source: BioPlex
RTL9
Tdark
Novelty: 0.20373514
Score: 0.78
Data Source: STRINGDB
RTL5
Tdark
Novelty: 0.10769891
Score: 0.737
Data Source: STRINGDB
RTL4
Tdark
Novelty: 0.04472757
Score: 0.645
Data Source: STRINGDB
MCRIP2
Tdark
Novelty: 5
Score: 0.569
Data Source: STRINGDB
ZCCHC3
Tdark
Novelty: 1.71428571
Score: 0.55
Data Source: STRINGDB
Publication Statistics
PubMed Score  5.51

PubMed score by year
PubTator Score  3.54

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGGGRGLLGRETLGPGGGCSGEGPLCYWPPPGSPPAPSLRASLPLEPPRCPLRSCSLPRSACLCSRNSAP
1-70
GSCCRPWASLWSEPPPSPSSQPAPPMYIWTLSCAPAASWAPVTHWTDHPLPPLPSPLLPTRLPDDYIILP
70-140
TDLRCHSHRHPSHPTDRLLLLVIWTHLGGIWAGHSPWTVIQTAGRPPRDLSPSARPISSPPPETSCVLA
140-209
MGGGRGLLGRETLGPGGGCSGEGPLCYWPPPGSPPAPSLRASLPLEPPRCPLRSCSLPRSACLCSRNSAPGSCCRPWASLWSEPPPSPSSQPAPPMYIWTLSCAPAASWAPVTHWTDHPLPPLPSPLLPTRLPDDYIILPTDLRCHSHRHPSHPTDRLLLLVIWTHLGGIWAGHSPWTVIQTAGRPPRDLSPSARPISSPPPETSCVLA