You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ACOX3
Peroxisomal acyl-coenzyme A oxidase 3

Protein Summary
Description
Oxidizes the CoA-esters of 2-methyl-branched fatty acids. Acyl-Coenzyme A oxidase 3 also know as pristanoyl -CoA oxidase (ACOX3)is involved in the desaturation of 2-methyl branched fatty acids in peroxisomes. Unlike the rat homolog, the human gene is expressed in very low amounts in liver such that its mRNA was undetectable by routine Northern-blot analysis or its product by immunoblotting or by enzyme activity measurements. However the human cDNA encoding a 700 amino acid protein with a peroxisomal targeting C-terminal tripeptide S-K-L was isolated and is thought to be expressed under special conditions such as specific developmental stages or in a tissue specific manner in tissues that have not yet been examined. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000356406
  • ENSP00000348775
  • ENSG00000087008
  • ENST00000413009
  • ENSP00000413994
  • ENST00000503233
  • ENSP00000421625

Symbol
  • BRCOX
  • PRCOX
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.94
transcription factor binding site profile
0.84
histone modification site profile
0.77
molecular function
0.73
protein domain
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.73   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 97   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.73   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 97   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (47)
Beta-oxidation of pristanoyl-CoA (R-HSA-389887)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Beta-oxidation of pristanoyl-CoA
Reactome
Fatty acid metabolism
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Peroxisomal lipid metabolism
Name
Explore in Pharos
Explore in Source
Beta-oxidation of pristanoyl-CoA
Fatty acid metabolism
Metabolism
Metabolism of lipids
Peroxisomal lipid metabolism
Gene Ontology Terms (13)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (116)
1 – 10 of 116
TMEM150A
Tbio
Novelty: 0.2020202
p_int: 0.999998266
p_ni: 0.00000144
p_wrong: 2.94e-7
Score: 0.252
Data Source: BioPlex,STRINGDB
MICU2
Tbio
Novelty: 0.08518406
p_int: 0.999991377
p_ni: 0.000008622
p_wrong: 1e-9
Score: 0.234
Data Source: BioPlex,STRINGDB
FKBP6
Tbio
Family: Enzyme
Novelty: 0.02749334
p_int: 0.996063274
p_ni: 0.000200167
p_wrong: 0.003736559
Score: 0.19
Data Source: BioPlex,STRINGDB
YTHDF1
Tbio
Novelty: 0.06012741
p_int: 0.969621843
p_ni: 0.030378157
Score: 0.191
Data Source: BioPlex,STRINGDB
HERC3
Tbio
Family: Enzyme
Novelty: 0.18068402
p_int: 0.963527521
p_ni: 0.036472479
Score: 0.217
Data Source: BioPlex,STRINGDB
CENPH
Tbio
Novelty: 0.03525011
p_int: 0.894629266
p_ni: 0.10537072
p_wrong: 1.4e-8
Score: 0.19
Data Source: BioPlex,STRINGDB
HAUS7
Tbio
Novelty: 1.2
p_int: 0.846209766
p_ni: 0.145441295
p_wrong: 0.008348939
Data Source: BioPlex
HSD17B4
Tbio
Novelty: 0.00700004
Score: 0.99
Data Source: STRINGDB
AMACR
Tbio
Family: Enzyme
Novelty: 0.0026828
Score: 0.982
Data Source: STRINGDB
EHHADH
Tbio
Novelty: 0.00763197
Score: 0.982
Data Source: STRINGDB
Publication Statistics
PubMed Score  12.73

PubMed score by year
PubTator Score  5.83

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASTVEGGDTALLPEFPRGPLDAYRARASFSWKELALFTEGEGMLRFKKTIFSALENDPLFARSPGADLS
1-70
LEKYRELNFLRCKRIFEYDFLSVEDMFKSPLKVPALIQCLGMYDSSLAAKYLLHSLVFGSAVYSSGSERH
70-140
LTYIQKIFRMEIFGCFALTELSHGSNTKAIRTTAHYDPATEEFIIHSPDFEAAKFWVGNMGKTATHAVVF
140-210
AKLCVPGDQCHGLHPFIVQIRDPKTLLPMPGVMVGDIGKKLGQNGLDNGFAMFHKVRVPRQSLLNRMGDV
210-280
TPEGTYVSPFKDVRQRFGASLGSLSSGRVSIVSLAILNLKLAVAIALRFSATRRQFGPTEEEEIPVLEYP
280-350
MQQWRLLPYLAAVYALDHFSKSLFLDLVELQRGLASGDRSARQAELGREIHALASASKPLASWTTQQGIQ
350-420
ECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQTSNYLLGLLAHQVHDGACFRSPLKSVDFLD
420-490
AYPGILDQKFEVSSVADCLDSAVALAAYKWLVCYLLRETYQKLNQEKRSGSSDFEARNKCQVSHGRPLAL
490-560
AFVELTVVQRFHEHVHQPSVPPSLRAVLGRLSALYALWSLSRHAALLYRGGYFSGEQAGEVLESAVLALC
560-630
SQLKDDAVALVDVIAPPDFVLDSPIGRADGELYKNLWGAVLQESKVLERASWWPEFSVNKPVIGSLKSKL
630-700
MASTVEGGDTALLPEFPRGPLDAYRARASFSWKELALFTEGEGMLRFKKTIFSALENDPLFARSPGADLSLEKYRELNFLRCKRIFEYDFLSVEDMFKSPLKVPALIQCLGMYDSSLAAKYLLHSLVFGSAVYSSGSERHLTYIQKIFRMEIFGCFALTELSHGSNTKAIRTTAHYDPATEEFIIHSPDFEAAKFWVGNMGKTATHAVVFAKLCVPGDQCHGLHPFIVQIRDPKTLLPMPGVMVGDIGKKLGQNGLDNGFAMFHKVRVPRQSLLNRMGDVTPEGTYVSPFKDVRQRFGASLGSLSSGRVSIVSLAILNLKLAVAIALRFSATRRQFGPTEEEEIPVLEYPMQQWRLLPYLAAVYALDHFSKSLFLDLVELQRGLASGDRSARQAELGREIHALASASKPLASWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQTSNYLLGLLAHQVHDGACFRSPLKSVDFLDAYPGILDQKFEVSSVADCLDSAVALAAYKWLVCYLLRETYQKLNQEKRSGSSDFEARNKCQVSHGRPLALAFVELTVVQRFHEHVHQPSVPPSLRAVLGRLSALYALWSLSRHAALLYRGGYFSGEQAGEVLESAVLALCSQLKDDAVALVDVIAPPDFVLDSPIGRADGELYKNLWGAVLQESKVLERASWWPEFSVNKPVIGSLKSKL