You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SCAMP2
Secretory carrier-associated membrane protein 2

Protein Classes
Protein Summary
Description
Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface. This gene product belongs to the SCAMP family of proteins which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes, and are usually expressed together. These findings suggest that the SCAMPs may function at the same site during vesicular transport rather than in separate pathways. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000268099
  • ENSP00000268099
  • ENSG00000140497
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.93
kinase perturbation
0.93
interacting protein
0.85
gene perturbation
0.76
cellular component
0.7


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.52   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 250   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.52   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 250   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (10)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (38)
1 – 10 of 38
LPAR1
Tchem
Family: GPCR
Novelty: 0.004102
p_int: 0.859989146
p_ni: 0.140010535
p_wrong: 3.19e-7
Score: 0.19
Data Source: BioPlex,STRINGDB
PLD1
Tchem
Family: Enzyme
Novelty: 0.00756297
Score: 0.932
Data Source: STRINGDB
PLD2
Tchem
Family: Enzyme
Novelty: 0.00368183
Score: 0.906
Data Source: STRINGDB
ATP5MG
Tdark
Family: Enzyme
Novelty: 0.44289782
Score: 0.83
Data Source: STRINGDB
PHB
Tbio
Novelty: 0.001936
Score: 0.822
Data Source: STRINGDB
BCAP31
Tbio
Novelty: 0.01745117
Score: 0.81
Data Source: STRINGDB
SLC9A7
Tbio
Family: Transporter
Novelty: 0.05301921
Score: 0.747
Data Source: STRINGDB
HDDC3
Tbio
Family: Enzyme
Novelty: 0.08510638
Score: 0.719
Data Source: STRINGDB
ARF6
Tbio
Family: Enzyme
Novelty: 0.00305495
Score: 0.706
Data Source: STRINGDB
SNAP23
Tbio
Novelty: 0.00732279
Score: 0.636
Data Source: STRINGDB
Publication Statistics
PubMed Score  11.52

PubMed score by year
PubTator Score  9.8

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPT
1-70
QPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTE
70-140
IPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSKGVDFGLSILWFLIFTPCAFLCWYRPIYKAF
140-210
RSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSV
210-280
FLLQRVHSLYRRTGASFQQAQEEFSQGIFSSRTFHRAASSAAQGAFQGN
280-329
MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSKGVDFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSVFLLQRVHSLYRRTGASFQQAQEEFSQGIFSSRTFHRAASSAAQGAFQGN