You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ZBTB5
Zinc finger and BTB domain-containing protein 5

Protein Summary
Description
May be involved in transcriptional regulation.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000307750
  • ENSP00000307604
  • ENSG00000168795

Symbol
  • KIAA0354
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.91
protein domain
0.85
transcription factor binding site profile
0.81
histone modification site profile
0.71
transcription factor
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.64   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 135   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.64   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 135   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (7)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (32)
1 – 10 of 32
GOPC
Tbio
Novelty: 0.0164207
p_int: 0.999999927
p_ni: 7e-8
p_wrong: 3e-9
Score: 0.15
Data Source: BioPlex,STRINGDB
NPRL2
Tbio
Family: Enzyme
Novelty: 0.04015797
p_int: 0.999998959
p_ni: 0.00000104
Score: 0.214
Data Source: BioPlex,STRINGDB
KLHL40
Tbio
Novelty: 0.0554492
p_int: 0.999788979
p_ni: 0.000210907
p_wrong: 1.14e-7
Score: 0.196
Data Source: BioPlex,STRINGDB
ZNF784
Tdark
Family: TF
p_int: 0.999379776
p_ni: 0.000346621
p_wrong: 0.000273603
Data Source: BioPlex
CDC16
Tbio
Novelty: 0.01336597
p_int: 0.997202636
p_ni: 0.002796595
p_wrong: 7.69e-7
Score: 0.15
Data Source: BioPlex,STRINGDB
SEC13
Tbio
Novelty: 0.0100577
p_int: 0.996021535
p_ni: 0.003978456
p_wrong: 8e-9
Score: 0.183
Data Source: BioPlex,STRINGDB
PDZK1P1
Tdark
p_int: 0.995338902
p_ni: 0.000365499
p_wrong: 0.004295599
Data Source: BioPlex
SAAL1
Tdark
Novelty: 0.4
Score: 0.686
Data Source: STRINGDB
ACTRT2
Tdark
Novelty: 0.69135802
Score: 0.602
Data Source: STRINGDB
OR4D10
Tdark
Family: oGPCR
Novelty: 2
Score: 0.594
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.64

PubMed score by year
PubTator Score  1.13

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALFSVAEGDQTMNMIQLDSE
1-70
VVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNSVVKACKHYLTTRTLPMSPPSERVQEQSARM
70-140
QRSFMLQQLGLSIVSSALNSSQNGEEQPAPMSSSMRSNLDQRTPFPMRRLHKRKQSAEERARQRLRPSID
140-210
ESAISDVTPENGPSGVHSREEFFSPDSLKIVDNPKADGMTDNQEDSAIMFDQSFGTQEDAQVPSQSDNSA
210-280
GNMAQLSMASRATQVETSFDQEAAPEKSSFQCENPEVGLGEKEHMRVVVKSEPLSSPEPQDEVSDVTSQA
280-350
EGSESVEVEGVVVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHKSTFSISNFLNKSRGNN
350-420
FTANQNNDDNIPNTTSDCRLESEAPYLLSPEAGPAGGPSSAPGSHVENPFSEPADSHFVRPMQEVMGLPC
420-490
VQTSGYQGGEQFGMDFSRSGLGLHSSFSRVMIGSPRGGASNFPYYRRIAPKMPVVTSVRSSQIPENSTSS
490-560
QLMMNGATSSFENGHPSQPGPPQLTRASADVLSKCKKALSEHNVLVVEGARKYACKICCKTFLTLTDCKK
560-630
HIRVHTGEKPYACLKCGKRFSQSSHLYKHSKTTCLRWQSSNLPSTLL
630-677
MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALFSVAEGDQTMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNSVVKACKHYLTTRTLPMSPPSERVQEQSARMQRSFMLQQLGLSIVSSALNSSQNGEEQPAPMSSSMRSNLDQRTPFPMRRLHKRKQSAEERARQRLRPSIDESAISDVTPENGPSGVHSREEFFSPDSLKIVDNPKADGMTDNQEDSAIMFDQSFGTQEDAQVPSQSDNSAGNMAQLSMASRATQVETSFDQEAAPEKSSFQCENPEVGLGEKEHMRVVVKSEPLSSPEPQDEVSDVTSQAEGSESVEVEGVVVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHKSTFSISNFLNKSRGNNFTANQNNDDNIPNTTSDCRLESEAPYLLSPEAGPAGGPSSAPGSHVENPFSEPADSHFVRPMQEVMGLPCVQTSGYQGGEQFGMDFSRSGLGLHSSFSRVMIGSPRGGASNFPYYRRIAPKMPVVTSVRSSQIPENSTSSQLMMNGATSSFENGHPSQPGPPQLTRASADVLSKCKKALSEHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSSHLYKHSKTTCLRWQSSNLPSTLL