You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
U2SURP
U2 snRNP-associated SURP motif-containing protein

IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.42   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 123   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.42   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 123   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
Metabolism of RNA (R-HSA-8953854)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of RNA
Reactome
Processing of Capped Intron-Containing Pre-mRNA
Reactome
mRNA Splicing
Reactome
mRNA Splicing - Major Pathway
Name
Explore in Pharos
Explore in Source
Metabolism of RNA
Processing of Capped Intron-Containing Pre-mRNA
mRNA Splicing
mRNA Splicing - Major Pathway
Gene Ontology Terms (4)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (232)
1 – 10 of 232
RBM17
Tbio
Novelty: 0.05783133
p_int: 0.999976791
p_ni: 0.000023209
Score: 0.985
Data Source: BioPlex,STRINGDB
PLOD1
Tbio
Family: Enzyme
Novelty: 0.00775503
p_int: 0.997504079
p_ni: 0.002495921
Data Source: BioPlex
SNRPE
Tbio
Novelty: 0.00150118
p_int: 0.992792453
p_ni: 0.007207547
Score: 0.934
Data Source: BioPlex,STRINGDB
PHF5A
Tbio
Family: Epigenetic
Novelty: 0.00307327
p_int: 0.983286308
p_ni: 0.016713691
Score: 0.914
Data Source: BioPlex,STRINGDB
FGFR2
Tclin
Family: Kinase
Novelty: 0.00077461
p_int: 0.982193566
p_ni: 0.017806434
Data Source: BioPlex
CSTF2T
Tbio
Novelty: 0.13915925
p_int: 0.974643906
p_ni: 0.025356092
p_wrong: 2e-9
Score: 0.919
Data Source: BioPlex,STRINGDB
SFSWAP
Tdark
Novelty: 0.32208589
p_int: 0.969198955
p_ni: 0.030801045
Score: 0.712
Data Source: BioPlex,STRINGDB
WDFY2
Tbio
Novelty: 0.00145875
p_int: 0.964361869
p_ni: 0.035638131
Score: 0.324
Data Source: BioPlex,STRINGDB
ZRSR2
Tbio
Novelty: 0.0875897
p_int: 0.939607217
p_ni: 0.060392783
Score: 0.638
Data Source: BioPlex,STRINGDB
SNRPB2
Tdark
Novelty: 0.29045643
p_int: 0.930657098
p_ni: 0.069342902
Score: 0.919
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  2.42

PubMed score by year
PubTator Score  0.45

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MADKTPGGSQKASSKTRSSDVHSSGSSDAHMDASGPSDSDMPSRTRPKSPRKHNYRNESARESLCDSPHQ
1-70
NLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEFLAAFEGSDGNKVKTFVRGGV
70-140
VNAAKEEHETDEKRGKIYKPSSRFADQKNPPNQSSNERPPSLLVIETKKPPLKKGEKEKKKSNLELFKEE
140-210
LKQIQEERDERHKTKGRLSRFEPPQSDSDGQRRSMDAPSRRNRSSGVLDDYAPGSHDVGDPSTTNLYLGN
210-280
INPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKL
280-350
GWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLKNPNAPMLPPPKNKEDFEKTLSQAIVKVV
350-420
IPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSILQGDSPTKWR
420-490
TEDFRMFKNGSFWRPPPLNPYLHGMSEEQETEAFVEEPSKKGALKEEQRDKLEEILRGLTPRKNDIGDAM
490-560
VFCLNNAEAAEEIVDCITESLSILKTPLPKKIARLYLVSDVLYNSSAKVANASYYRKFFETKLCQIFSDL
560-630
NATYRTIQGHLQSENFKQRVMTCFRAWEDWAIYPEPFLIKLQNIFLGLVNIIEEKETEDVPDDLDGAPIE
630-700
EELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELE
700-770
AQAVTTSKWELFDQHEESEEEENQNQEEESEDEEDTQSSKSEEHHLYSNPIKEEMTESKFSKYSEMSEEK
770-840
RAKLREIELKVMKFQDELESGKRPKKPGQSFQEQVEHYRDKLLQREKEKELERERERDKKDKEKLESRSK
840-910
DKKEKDECTPTRKERKRRHSTSPSPSRSSSGRRVKSPSPKSERSERSERSHKESSRSRSSHKDSPRDVSK
910-980
KAKRSPSGSRTPKRSRRSRSRSPKKSGKKSRSQSRSPHRSHKKSKKNKH
980-1029
MADKTPGGSQKASSKTRSSDVHSSGSSDAHMDASGPSDSDMPSRTRPKSPRKHNYRNESARESLCDSPHQNLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEFLAAFEGSDGNKVKTFVRGGVVNAAKEEHETDEKRGKIYKPSSRFADQKNPPNQSSNERPPSLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERHKTKGRLSRFEPPQSDSDGQRRSMDAPSRRNRSSGVLDDYAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLKNPNAPMLPPPKNKEDFEKTLSQAIVKVVIPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSILQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSEEQETEAFVEEPSKKGALKEEQRDKLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCITESLSILKTPLPKKIARLYLVSDVLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRVMTCFRAWEDWAIYPEPFLIKLQNIFLGLVNIIEEKETEDVPDDLDGAPIEEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWELFDQHEESEEEENQNQEEESEDEEDTQSSKSEEHHLYSNPIKEEMTESKFSKYSEMSEEKRAKLREIELKVMKFQDELESGKRPKKPGQSFQEQVEHYRDKLLQREKEKELERERERDKKDKEKLESRSKDKKEKDECTPTRKERKRRHSTSPSPSRSSSGRRVKSPSPKSERSERSERSHKESSRSRSSHKDSPRDVSKKAKRSPSGSRTPKRSRRSRSRSPKKSGKKSRSQSRSPHRSHKKSKKNKH