You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
GAK
Cyclin-G-associated kinase

Protein Summary
Description
Associates with cyclin G and CDK5. Seems to act as an auxilin homolog that is involved in the uncoating of clathrin-coated vesicles by Hsc70 in non-neuronal cells. Expression oscillates slightly during the cell cycle, peaking at G1. In all eukaryotes, the cell cycle is governed by cyclin-dependent protein kinases (CDKs), whose activities are regulated by cyclins and CDK inhibitors in a diverse array of mechanisms that involve the control of phosphorylation and dephosphorylation of Ser, Thr or Tyr residues. Cyclins are molecules that possess a consensus domain called the 'cyclin box.' In mammalian cells, 9 cyclin species have been identified, and they are referred to as cyclins A through I. Cyclin G is a direct transcriptional target of the p53 tumor suppressor gene product and thus functions downstream of p53. GAK is an association partner of cyclin G and CDK5. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000314167
  • ENSP00000314499
  • ENSG00000178950
  • ENST00000511163
  • ENSP00000421361

Symbol
  • DNAJ26
  • DNAJC26
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
small molecule
1
protein domain
0.97
drug perturbation
0.96
disease perturbation
0.95
molecular function
0.91


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 75.95   (req: < 5)
Gene RIFs: 30   (req: <= 3)
Antibodies: 293   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 75.95   (req: >= 5)
Gene RIFs: 30   (req: > 3)
Antibodies: 293   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 19
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 11
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 6
Protein Data Bank (7)
1 – 5 of 7
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
Clathrin-mediated endocytosis (R-HSA-8856828)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Clathrin-mediated endocytosis
Reactome
Golgi Associated Vesicle Biogenesis
Reactome
Membrane Trafficking
Reactome
Vesicle-mediated transport
Reactome
trans-Golgi Network Vesicle Budding
Name
Explore in Pharos
Explore in Source
Clathrin-mediated endocytosis
Golgi Associated Vesicle Biogenesis
Membrane Trafficking
Vesicle-mediated transport
trans-Golgi Network Vesicle Budding
Gene Ontology Terms (28)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
ParkinsonsUK-UCL
Traceable Author Statement (TAS)
BHF-UCL
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (345)
1 – 10 of 345
STAMBPL1
Tbio
Family: Enzyme
Novelty: 0.2201625
p_int: 0.999989347
p_ni: 0.000010652
Score: 0.595
Data Source: BioPlex,STRINGDB
GPX7
Tbio
Family: Enzyme
Novelty: 0.02063033
p_int: 0.999968788
p_ni: 0.000031212
Data Source: BioPlex
DAPP1
Tbio
Novelty: 0.07746533
p_int: 0.999636866
p_ni: 0.000363133
p_wrong: 2e-9
Data Source: BioPlex
HSPA8
Tchem
Novelty: 0.00100906
p_int: 0.999445901
p_ni: 0.000554097
p_wrong: 2e-9
Score: 0.994
Data Source: BioPlex,STRINGDB
STAMBP
Tbio
Novelty: 0.02642988
p_int: 0.99942816
p_ni: 0.000571839
p_wrong: 1e-9
Score: 0.381
Data Source: BioPlex,STRINGDB
S100A4
Tbio
Novelty: 0.00156469
p_int: 0.99894398
p_ni: 0.001056016
p_wrong: 4e-9
Data Source: BioPlex
RABGEF1
Tbio
Novelty: 0.03493884
p_int: 0.995729417
p_ni: 0.00427058
p_wrong: 3e-9
Score: 0.527
Data Source: BioPlex,STRINGDB
HSPBP1
Tbio
Novelty: 0.01599246
p_int: 0.99331541
p_ni: 0.00668459
Score: 0.158
Data Source: BioPlex,STRINGDB
DMWD
Tbio
Novelty: 0.01733102
p_int: 0.99301929
p_ni: 0.00698071
Score: 0.432
Data Source: BioPlex,STRINGDB
HIP1R
Tbio
Novelty: 0.03034966
p_int: 0.969561543
p_ni: 0.030429769
p_wrong: 0.000008688
Score: 0.993
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  75.95

PubMed score by year
PubTator Score  42.02

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKR
1-70
LLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESR
70-140
GPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPDYSWSAQR
140-210
RALVEEEITRNTTPMYRTPEIIDLYSNFPIGEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPP
210-280
HDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQEIAAARNVNPKSPITELLEQNGGYGSATLSRGPPPP
280-350
VGPAGSGYSGGLALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSVANYAKGDLDISYITSRIAVM
350-420
SFPAEGVESALKNNIEDVRLFLDSKHPGHYAVYNLSPRTYRPSRFHNRVSECGWAARRAPHLHTLYNICR
420-490
NMHAWLRQDHKNVCVVHCMDGRAASAVAVCSFLCFCRLFSTAEAAVYMFSMKRCPPGIWPSHKRYIEYMC
490-560
DMVAEEPITPHSKPILVRAVVMTPVPLFSKQRSGCRPFCEVYVGDERVASTSQEYDKMRDFKIEDGKAVI
560-630
PLGVTVQGDVLIVIYHARSTLGGRLQAKMASMKMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDL
630-700
FQVNLEVEVEPRDRPSREAPPWENSSMRGLNPKILFSSREEQQDILSKFGKPELPRQPGSTAQYDAGAGS
700-770
PEAEPTDSDSPPSSSADASRFLHTLDWQEEKEAETGAENASSKESESALMEDRDESEVSDEGGSPISSEG
770-840
QEPRADPEPPGLAAGLVQQDLVFEVETPAVLPEPVPQEDGVDLLGLHSEVGAGPAVPPQACKAPSSNTDL
840-910
LSCLLGPPEAASQGPPEDLLSEDPLLLASPAPPLSVQSTPRGGPPAAADPFGPLLPSSGNNSQPCSNPDL
910-980
FGEFLNSDSVTVPPSFPSAHSAPPPSCSADFLHLGDLPGEPSKMTASSSNPDLLGGWAAWTETAASAVAP
980-1050
TPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQ
1050-1120
TSRPPAQGASWPPQAKPPPKACTQPRPNYASNFSVIGAREERGVRAPSFAQKPKVSENDFEDLLSNQGFS
1120-1190
SRSDKKGPKTIAEMRKQDLAKDTDPLKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVGMADLVAP
1190-1260
EQVKKHYRRAVLAVHPDKAAGQPYEQHAKMIFMELNDAWSEFENQGSRPLF
1260-1311
MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPDYSWSAQRRALVEEEITRNTTPMYRTPEIIDLYSNFPIGEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPPHDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQEIAAARNVNPKSPITELLEQNGGYGSATLSRGPPPPVGPAGSGYSGGLALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSVANYAKGDLDISYITSRIAVMSFPAEGVESALKNNIEDVRLFLDSKHPGHYAVYNLSPRTYRPSRFHNRVSECGWAARRAPHLHTLYNICRNMHAWLRQDHKNVCVVHCMDGRAASAVAVCSFLCFCRLFSTAEAAVYMFSMKRCPPGIWPSHKRYIEYMCDMVAEEPITPHSKPILVRAVVMTPVPLFSKQRSGCRPFCEVYVGDERVASTSQEYDKMRDFKIEDGKAVIPLGVTVQGDVLIVIYHARSTLGGRLQAKMASMKMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDLFQVNLEVEVEPRDRPSREAPPWENSSMRGLNPKILFSSREEQQDILSKFGKPELPRQPGSTAQYDAGAGSPEAEPTDSDSPPSSSADASRFLHTLDWQEEKEAETGAENASSKESESALMEDRDESEVSDEGGSPISSEGQEPRADPEPPGLAAGLVQQDLVFEVETPAVLPEPVPQEDGVDLLGLHSEVGAGPAVPPQACKAPSSNTDLLSCLLGPPEAASQGPPEDLLSEDPLLLASPAPPLSVQSTPRGGPPAAADPFGPLLPSSGNNSQPCSNPDLFGEFLNSDSVTVPPSFPSAHSAPPPSCSADFLHLGDLPGEPSKMTASSSNPDLLGGWAAWTETAASAVAPTPATEGPLFSPGGQPAPCGSQASWTKSQNPDPFADLGDLSSGLQGSPAGFPPGGFIPKTATTPKGSSSWQTSRPPAQGASWPPQAKPPPKACTQPRPNYASNFSVIGAREERGVRAPSFAQKPKVSENDFEDLLSNQGFSSRSDKKGPKTIAEMRKQDLAKDTDPLKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVGMADLVAPEQVKKHYRRAVLAVHPDKAAGQPYEQHAKMIFMELNDAWSEFENQGSRPLF