You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SLC27A2
Very long-chain acyl-CoA synthetase

Protein Summary
Description
Acyl-CoA synthetase probably involved in bile acid metabolism. Proposed to activate C27 precursors of bile acids to their CoA thioesters derivatives before side chain cleavage via peroxisomal beta-oxidation occurs. In vitro, activates 3-alpha,7-alpha,12-alpha-trihydroxy-5-beta-cholestanate (THCA), the C27 precursor of cholic acid deriving from the de novo synthesis from cholesterol. Does not utilize C24 bile acids as substrates. In vitro, also activates long- and branched-chain fatty acids and may have additional roles in fatty acid metabolism. May be involved in translocation of long-chain fatty acids (LFCA) across membranes (By similarity). The protein encoded by this gene is an isozyme of long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty aci ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000267842
  • ENSP00000267842
  • ENSG00000140284
  • ENST00000380902
  • ENSP00000370289

Symbol
  • ACSVL1
  • FACVL1
  • FATP2
  • VLACS
  • VLCS
  • FATP2
  • VLACS
  • ACSVL1
  • FACVL1
  • hFACVL1
  • HsT17226
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.99
gene perturbation
0.98
molecular function
0.98
PubMedID
0.95
histone modification site profile
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 60.2   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 167   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 60.2   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 167   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 19
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (25)
Alpha-oxidation of phytanate (R-HSA-389599)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Alpha-oxidation of phytanate
Reactome
Bile acid and bile salt metabolism
Reactome
Fatty acid metabolism
Reactome
Immune System
Reactome
Innate Immune System
Name
Explore in Pharos
Explore in Source
Alpha-oxidation of phytanate
Bile acid and bile salt metabolism
Fatty acid metabolism
Immune System
Innate Immune System
Gene Ontology Terms (29)
Items per page:
10
1 – 10 of 10
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Protein-Protein Interactions (219)
1 – 10 of 219
SCGB2A1
Tbio
Novelty: 0.00455624
p_int: 0.999926282
p_ni: 0.000073718
Data Source: BioPlex
RANBP6
Tdark
Novelty: 2.35714286
p_int: 0.999706887
p_ni: 0.000293113
Data Source: BioPlex
PPP6R2
Tbio
Family: Enzyme
Novelty: 0.01723654
p_int: 0.999681588
p_ni: 0.000318412
Data Source: BioPlex
HAUS7
Tbio
Novelty: 1.2
p_int: 0.998749533
p_ni: 0.001250467
Data Source: BioPlex
SCGB2A2
Tbio
Novelty: 0.01762536
p_int: 0.997246466
p_ni: 0.002753534
Data Source: BioPlex
ARMC6
Tdark
Novelty: 0.77922078
p_int: 0.996703591
p_ni: 0.003296409
Data Source: BioPlex
MINDY2
Tbio
Novelty: 0.5060241
p_int: 0.992228593
p_ni: 0.007771407
Data Source: BioPlex
FAM177A1
Tdark
Novelty: 0.47806132
p_int: 0.991186157
p_ni: 0.008813843
Data Source: BioPlex
BCL2L2
Tchem
Novelty: 0.0074087
p_int: 0.984597891
p_ni: 0.015402109
Score: 0.18
Data Source: BioPlex,STRINGDB
PNPLA3
Tbio
Family: Enzyme
Novelty: 0.00237325
p_int: 0.964647678
p_ni: 0.035352322
Score: 0.464
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  60.20

PubMed score by year
PubTator Score  33.4

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLSAIYTVLAGLLFLPLLVNLCCPYFFQDIGYFLKVAAVGRRVRSYGKRRPARTILRAFLEKARQTPHKP
1-70
FLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLWLGLVKLGCAMACLNYNIRA
70-140
KSLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIYYVSRTSNTDGIDSFLDKVDEVSTEPIPESW
140-210
RSEVTFSTPALYIYTSGTTGLPKAAMITHQRIWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCI
210-280
VAGATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFV
280-350
KRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKG
350-420
EVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGE
420-490
NVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLR
490-560
IQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAKMYVPMTEDIYNAISAKTLKL
560-620
MLSAIYTVLAGLLFLPLLVNLCCPYFFQDIGYFLKVAAVGRRVRSYGKRRPARTILRAFLEKARQTPHKPFLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLWLGLVKLGCAMACLNYNIRAKSLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIYYVSRTSNTDGIDSFLDKVDEVSTEPIPESWRSEVTFSTPALYIYTSGTTGLPKAAMITHQRIWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCIVAGATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKGEVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAKMYVPMTEDIYNAISAKTLKL