You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CASQ2
Calsequestrin-2

Protein Summary
Description
Calsequestrin is a high-capacity, moderate affinity, calcium-binding protein and thus acts as an internal calcium store in muscle. Calcium ions are bound by clusters of acidic residues at the protein surface, especially at the interface between subunits. Can bind around 60 Ca(2+) ions. Regulates the release of lumenal Ca(2+) via the calcium release channel RYR2; this plays an important role in triggering muscle contraction. Plays a role in excitation-contraction coupling in the heart and in regulating the rate of heart beats. The protein encoded by this gene specifies the cardiac muscle family member of the calsequestrin family. Calsequestrin is localized to the sarcoplasmic reticulum in cardiac and slow skeletal muscle cells. The protein is a calcium binding protein that stores calcium for muscle function. Mutations in this gene cause stress-induced polymorphic ventricular tachycardia, also referred to as catecholaminergic polymorphic ventricular tachycardia 2 (CPVT2), a disease chara ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000261448
  • ENSP00000261448
  • ENSG00000118729

Symbol
  • PDIB2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cellular component
0.89
biological process
0.88
PubMedID
0.66
tissue
0.52
transcription factor binding site profile
0.5


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 95.61   (req: < 5)
Gene RIFs: 37   (req: <= 3)
Antibodies: 274   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 95.61   (req: >= 5)
Gene RIFs: 37   (req: > 3)
Antibodies: 274   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 22
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Protein-Protein Interactions (144)
1 – 10 of 144
ZBTB21
Tbio
Family: TF
Novelty: 0.32967033
p_int: 0.999999645
p_ni: 3.55e-7
Data Source: BioPlex
ASB1
Tdark
Novelty: 0.09316254
p_int: 0.999997594
p_ni: 0.000002403
p_wrong: 3e-9
Score: 0.21
Data Source: BioPlex,STRINGDB
KLHL11
Tdark
Novelty: 0.39728266
p_int: 0.999993234
p_ni: 0.000006766
Score: 0.16
Data Source: BioPlex,STRINGDB
FBXW8
Tbio
Novelty: 0.08804388
p_int: 0.999988782
p_ni: 0.000008842
p_wrong: 0.000002376
Data Source: BioPlex
EPB41L4B
Tbio
Novelty: 0.20172764
p_int: 0.99998698
p_ni: 0.000012814
p_wrong: 2.06e-7
Score: 0.204
Data Source: BioPlex,STRINGDB
CUL7
Tbio
Novelty: 0.03071523
p_int: 0.999956174
p_ni: 0.000043826
Data Source: BioPlex
DAXX
Tbio
Novelty: 0.00430069
p_int: 0.999868691
p_ni: 0.000131309
Score: 0.185
Data Source: BioPlex,STRINGDB
PRDM10
Tbio
Family: TF; Epigenetic
Novelty: 0.00009655
p_int: 0.999848645
p_ni: 0.000151355
Data Source: BioPlex
MARK3
Tchem
Family: Kinase
Novelty: 0.00310794
p_int: 0.999768207
p_ni: 0.000231792
Data Source: BioPlex
ZFP91
Tbio
Family: TF
Novelty: 0.02001763
p_int: 0.999546644
p_ni: 0.000453236
p_wrong: 1.21e-7
Data Source: BioPlex
Publication Statistics
PubMed Score  95.61

PubMed score by year
PubTator Score  75.68

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKRTHLFIVGIYFLSSCRAEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQF
1-70
QLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLD
70-140
LIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLK
140-210
MNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPD
210-280
GYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDD
280-350
DLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE
350-399
MKRTHLFIVGIYFLSSCRAEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE