You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RGS13
Regulator of G-protein signaling 13

Protein Summary
Description
Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to both G(i)-alpha and G(q)-alpha (By similarity). The protein encoded by this gene is a member of the regulator of G protein signaling (RGS) family. RGS family members share similarity with S. cerevisiae SST2 and C. elegans egl-10 proteins, which contain a characteristic conserved RGS domain. RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their inactive GDP-bound form, thus negatively regulating G protein signaling. RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation. The biological function of this gene, however, is unknown. Two transcript variants encoding the same isoform exist. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000391995
  • ENSP00000375853
  • ENSG00000127074
  • ENST00000543215
  • ENSP00000442837
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
pathway
0.63
gene perturbation
0.61
phenotype
0.56
PubMedID
0.51
cell line
0.49


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.89   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 221   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.89   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 221   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (13)
G alpha (i) signalling events (R-HSA-418594)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
G alpha (i) signalling events
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
Signal Transduction
Reactome
Signaling by GPCR
Name
Explore in Pharos
Explore in Source
G alpha (i) signalling events
G alpha (q) signalling events
GPCR downstream signalling
Signal Transduction
Signaling by GPCR
Gene Ontology Terms (5)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (42)
1 – 10 of 42
CCDC140
Tdark
Novelty: 8
p_int: 0.998495109
p_ni: 0.000591524
p_wrong: 0.000913367
Score: 0.359
Data Source: BioPlex,STRINGDB
LIN9
Tbio
Novelty: 0.00193435
p_int: 0.99675776
p_ni: 0.00324224
Score: 0.189
Data Source: BioPlex,STRINGDB
SLAMF1
Tbio
Novelty: 0.00121506
p_int: 0.948333826
p_ni: 0.051666152
p_wrong: 2.3e-8
Score: 0.154
Data Source: BioPlex,STRINGDB
SRRT
Tbio
Novelty: 0.00367694
p_int: 0.914596815
p_ni: 0.085403184
Score: 0.221
Data Source: BioPlex,STRINGDB
CIAO1
Tbio
Novelty: 0.04042313
p_int: 0.765398358
p_ni: 0.234601642
Score: 0.225
Data Source: BioPlex,STRINGDB
GNAI2
Tbio
Novelty: 0.04542644
Score: 0.964
Data Source: STRINGDB
GNAI1
Tbio
Novelty: 0.12575547
Score: 0.947
Data Source: STRINGDB
GNAI3
Tbio
Novelty: 0.03936457
Score: 0.941
Data Source: STRINGDB
GNAT3
Tbio
Novelty: 0.004945
Score: 0.93
Data Source: STRINGDB
GNA12
Tbio
Novelty: 0.09944323
Score: 0.737
Data Source: STRINGDB
Publication Statistics
PubMed Score  7.89

PubMed score by year
PubTator Score  6.27

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETY
1-70
KKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRF
70-140
LKSEMYQKLLKTMQSNNSF
140-159
MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF