You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TNFRSF13B
Tumor necrosis factor receptor superfamily member 13B

Protein Summary
Description
Receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS that binds both ligands with similar high affinity. Mediates calcineurin-dependent activation of NF-AT, as well as activation of NF-kappa-B and AP-1. Involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (TNF) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (CAML). The protein induces activation of the transcription factors NFAT, AP1, and NF-kappa-B and plays a crucial role in humoral immunity by interacting with a TNF ligand. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000261652
  • ENSP00000261652
  • ENSG00000240505
  • ENST00000583789
  • ENSP00000462952

Symbol
  • TACI
  • CVID
  • RYZN
  • TACI
  • CD267
  • CVID2
  • IGAD2
  • TNFRSF14B
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.8
phenotype
0.73
biological term
0.72
cell type or tissue
0.7
disease
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 217.31   (req: < 5)
Gene RIFs: 83   (req: <= 3)
Antibodies: 571   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 217.31   (req: >= 5)
Gene RIFs: 83   (req: > 3)
Antibodies: 571   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (9)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
TNFR2 non-canonical NF-kB pathway
Reactome
TNFs bind their physiological receptors
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
TNFR2 non-canonical NF-kB pathway
TNFs bind their physiological receptors
Gene Ontology Terms (9)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (94)
1 – 10 of 94
FIZ1
Tdark
Family: TF
Novelty: 0.4990099
p_int: 0.999999552
p_ni: 2.08e-7
p_wrong: 2.4e-7
Score: 0.187
Data Source: BioPlex,STRINGDB
ZNF579
Tdark
Family: TF
p_int: 0.999999464
p_ni: 5.36e-7
Data Source: BioPlex
ZNF646
Tdark
Family: TF
Novelty: 7
p_int: 0.999998927
p_ni: 0.000001073
Score: 0.157
Data Source: BioPlex,STRINGDB
CD70
Tbio
Novelty: 0.00552433
p_int: 0.999996663
p_ni: 0.00000151
p_wrong: 0.000001827
Score: 0.459
Data Source: BioPlex,STRINGDB
RBM26
Tdark
Novelty: 0.86538462
p_int: 0.999987427
p_ni: 0.000012573
Score: 0.177
Data Source: BioPlex,STRINGDB
RBM27
Tdark
Novelty: 0.08291698
p_int: 0.999986069
p_ni: 0.000013931
Data Source: BioPlex
ZFP91
Tbio
Family: TF
Novelty: 0.02001763
p_int: 0.999872412
p_ni: 0.000126492
p_wrong: 0.000001097
Data Source: BioPlex
RRP1
Tbio
Novelty: 0.19007392
p_int: 0.9997464
p_ni: 0.0002536
Data Source: BioPlex
ZNF638
Tbio
Novelty: 0.18775145
p_int: 0.999595904
p_ni: 0.000404096
Data Source: BioPlex
RBM23
Tbio
Novelty: 0.04692475
p_int: 0.998608898
p_ni: 0.001391092
p_wrong: 1e-8
Data Source: BioPlex
Publication Statistics
PubMed Score  217.31

PubMed score by year
PubTator Score  159.45

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLS
1-70
CRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLE
70-140
HRGSEASPALPGLKLSADQVALVYSTLGLCLCAVLCCFLVAVACFLKKRGDPCSCQPRSRPRQSPAKSSQ
140-210
DHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLG
210-280
IVCVPAQEGGPGA
280-293
MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYSTLGLCLCAVLCCFLVAVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA