Protein Summary
Positively regulates a late step in exocytosis of various cytoplasmic vesicles, such as synaptic vesicles and other secretory vesicles (PubMed:21785414). Organizes the SNAREs into a cross-linked zigzag topology that, when interposed between the vesicle and plasma membranes, is incompatible with fusion, thereby preventing SNAREs from releasing neurotransmitters until an action potential arrives at the synapse (PubMed:21785414). Also involved in glucose-induced secretion of insulin by pancreatic beta-cells. Essential for motor behavior. Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. [provided by RefSeq, Jul 2008]
- ENST00000304062
- ENSP00000305613
- ENSG00000168993
- CPX1
- CPX-I
- EIEE63
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
interacting protein | 0.87 | ||
tissue | 0.62 | ||
transcription factor perturbation | 0.61 | ||
gene perturbation | 0.59 | ||
PubMedID | 0.59 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 88.77 (req: < 5)
Gene RIFs: 16 (req: <= 3)
Antibodies: 158 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 88.77 (req: >= 5)
Gene RIFs: 16 (req: > 3)
Antibodies: 158 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 11
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id | Ligand | Method | Resolution (Ã…) | M.W. (kDa) | Pub Year | Title |
---|
PDB Structure Id | M.W. | Resolution | Pub Year |
---|
Pathways (11)
Reactome (9)
KEGG (1)
WikiPathways (1)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 9
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Acetylcholine Neurotransmitter Release Cycle | ||||
Reactome | Dopamine Neurotransmitter Release Cycle | ||||
Reactome | GABA synthesis, release, reuptake and degradation | ||||
Reactome | Glutamate Neurotransmitter Release Cycle | ||||
Reactome | Neuronal System | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Acetylcholine Neurotransmitter Release Cycle | ||||
Dopamine Neurotransmitter Release Cycle | ||||
GABA synthesis, release, reuptake and degradation | ||||
Glutamate Neurotransmitter Release Cycle | ||||
Neuronal System | ||||
Gene Ontology Terms (22)
Functions (3)
Components (11)
Processes (8)
Items per page:
10
1 – 3 of 3
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Inferred from Electronic Annotation (IEA) | Ensembl | |||
Inferred from Electronic Annotation (IEA) | Ensembl | |||
Protein-Protein Interactions (165)
1 – 10 of 165
CPLX2
Novelty: 0.01904583
p_int: 0.999999976
p_ni: 2.4e-8
Score: 0.898
Data Source: BioPlex,STRINGDB
VAMP3
Novelty: 0.00974462
p_int: 0.922868393
p_ni: 0.077131347
p_wrong: 2.6e-7
Score: 0.841
Data Source: BioPlex,STRINGDB
GYPB
Novelty: 0.00257625
p_int: 0.810195139
p_ni: 0.189750613
p_wrong: 0.000054248
Score: 0.173
Data Source: BioPlex,STRINGDB
SYT1
Novelty: 0.00202951
Score: 0.998
Data Source: STRINGDB
SNAP25
Novelty: 0.0020914
Score: 0.998
Data Source: STRINGDB
STX1A
Novelty: 0.00128938
Score: 0.996
Data Source: STRINGDB
VAMP2
Novelty: 0.00274235
Score: 0.988
Data Source: STRINGDB
RAB3A
Family: Enzyme
Novelty: 0.00506015
Score: 0.97
Data Source: STRINGDB
SYT2
Novelty: 0.01076581
Score: 0.969
Data Source: STRINGDB
SYN2
Novelty: 0.00508386
Score: 0.968
Data Source: STRINGDB
Publication Statistics
PubMed Score 88.77
PubMed score by year
PubTator Score 41.32
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAEREAVRQGIRDKY
1-70
GIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEVEEEDESILDTVIKYLPGPLQDMLKK
70-134
MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAEREAVRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEVEEEDESILDTVIKYLPGPLQDMLKK
Find similar targets by: