You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CPLX1
Complexin-1

Protein Summary
Description
Positively regulates a late step in exocytosis of various cytoplasmic vesicles, such as synaptic vesicles and other secretory vesicles (PubMed:21785414). Organizes the SNAREs into a cross-linked zigzag topology that, when interposed between the vesicle and plasma membranes, is incompatible with fusion, thereby preventing SNAREs from releasing neurotransmitters until an action potential arrives at the synapse (PubMed:21785414). Also involved in glucose-induced secretion of insulin by pancreatic beta-cells. Essential for motor behavior. Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000304062
  • ENSP00000305613
  • ENSG00000168993

Symbol
  • CPX1
  • CPX-I
  • EIEE63
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
0.87
tissue
0.62
transcription factor perturbation
0.61
gene perturbation
0.59
PubMedID
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 88.77   (req: < 5)
Gene RIFs: 16   (req: <= 3)
Antibodies: 158   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 88.77   (req: >= 5)
Gene RIFs: 16   (req: > 3)
Antibodies: 158   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (11)
Acetylcholine Neurotransmitter Release Cycle (R-HSA-264642)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Acetylcholine Neurotransmitter Release Cycle
Reactome
Dopamine Neurotransmitter Release Cycle
Reactome
GABA synthesis, release, reuptake and degradation
Reactome
Glutamate Neurotransmitter Release Cycle
Reactome
Neuronal System
Name
Explore in Pharos
Explore in Source
Acetylcholine Neurotransmitter Release Cycle
Dopamine Neurotransmitter Release Cycle
GABA synthesis, release, reuptake and degradation
Glutamate Neurotransmitter Release Cycle
Neuronal System
Gene Ontology Terms (22)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (165)
1 – 10 of 165
CPLX2
Tbio
Novelty: 0.01904583
p_int: 0.999999976
p_ni: 2.4e-8
Score: 0.898
Data Source: BioPlex,STRINGDB
VAMP3
Tbio
Novelty: 0.00974462
p_int: 0.922868393
p_ni: 0.077131347
p_wrong: 2.6e-7
Score: 0.841
Data Source: BioPlex,STRINGDB
GYPB
Tbio
Novelty: 0.00257625
p_int: 0.810195139
p_ni: 0.189750613
p_wrong: 0.000054248
Score: 0.173
Data Source: BioPlex,STRINGDB
SYT1
Tbio
Novelty: 0.00202951
Score: 0.998
Data Source: STRINGDB
SNAP25
Tclin
Novelty: 0.0020914
Score: 0.998
Data Source: STRINGDB
STX1A
Tbio
Novelty: 0.00128938
Score: 0.996
Data Source: STRINGDB
VAMP2
Tbio
Novelty: 0.00274235
Score: 0.988
Data Source: STRINGDB
RAB3A
Tbio
Family: Enzyme
Novelty: 0.00506015
Score: 0.97
Data Source: STRINGDB
SYT2
Tbio
Novelty: 0.01076581
Score: 0.969
Data Source: STRINGDB
SYN2
Tbio
Novelty: 0.00508386
Score: 0.968
Data Source: STRINGDB
Publication Statistics
PubMed Score  88.77

PubMed score by year
PubTator Score  41.32

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAEREAVRQGIRDKY
1-70
GIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEVEEEDESILDTVIKYLPGPLQDMLKK
70-134
MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAEREAVRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEVEEEDESILDTVIKYLPGPLQDMLKK