You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GOSR2
Golgi SNAP receptor complex member 2

Protein Summary
Description
Involved in transport of proteins from the cis/medial-Golgi to the trans-Golgi network. This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension. [provided by RefSeq, Mar 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000225567
  • ENSP00000225567
  • ENSG00000108433
  • ENST00000640051
  • ENSP00000492751
  • ENST00000640621
  • ENSP00000492830

Symbol
  • GS27
  • Bos1
  • EPM6
  • GS27
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.98
transcription factor perturbation
0.91
interacting protein
0.85
disease perturbation
0.83
transcription factor binding site profile
0.81


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 22.13   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 133   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 22.13   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 133   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (17)
Asparagine N-linked glycosylation (R-HSA-446203)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Asparagine N-linked glycosylation
Reactome
COPI-mediated anterograde transport
Reactome
COPII-mediated vesicle transport
Reactome
Cargo concentration in the ER
Reactome
ER to Golgi Anterograde Transport
Name
Explore in Pharos
Explore in Source
Asparagine N-linked glycosylation
COPI-mediated anterograde transport
COPII-mediated vesicle transport
Cargo concentration in the ER
ER to Golgi Anterograde Transport
Gene Ontology Terms (20)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (206)
1 – 10 of 206
STX7
Tbio
Novelty: 0.052457
p_int: 0.99998756
p_ni: 0.000012439
Score: 0.904
Data Source: BioPlex,STRINGDB
STX6
Tbio
Novelty: 0.01577464
p_int: 0.999955537
p_ni: 0.000044463
Score: 0.983
Data Source: BioPlex,STRINGDB
CSGALNACT2
Tbio
Family: Enzyme
Novelty: 0.1003811
p_int: 0.999950801
p_ni: 0.000049199
Data Source: BioPlex
DKK3
Tbio
Novelty: 0.00427648
p_int: 0.9999392
p_ni: 0.0000608
Data Source: BioPlex
CLEC12A
Tbio
Novelty: 0.02175617
p_int: 0.999907713
p_ni: 0.000092262
p_wrong: 2.5e-8
Score: 0.668
Data Source: BioPlex,STRINGDB
STX12
Tbio
Novelty: 0.07003045
p_int: 0.999881846
p_ni: 0.000118108
p_wrong: 4.6e-8
Score: 0.951
Data Source: BioPlex,STRINGDB
SEC22B
Tbio
Novelty: 0.04196763
p_int: 0.999808827
p_ni: 0.000189857
p_wrong: 0.000001316
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
TRDN
Tbio
Novelty: 0.00251509
p_int: 0.994643317
p_ni: 0.005356679
p_wrong: 4e-9
Score: 0.212
Data Source: BioPlex,STRINGDB
VAMP4
Tbio
Novelty: 0.04197927
p_int: 0.99394878
p_ni: 0.006051218
p_wrong: 2e-9
Score: 0.979
Data Source: BioPlex,STRINGDB
STX5
Tbio
Novelty: 0.01314285
Score: 0.999
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  22.13

PubMed score by year
PubTator Score  15.97

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRV
1-70
DQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDL
70-140
ILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQY
140-210
LT
210-212
MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQYLT