You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DYNC1I1
Cytoplasmic dynein 1 intermediate chain 1

Protein Summary
Description
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the binding of dynein to dynactin via its 150 kDa component (p150-glued) DCNT1. May play a role in mediating the interaction of cytoplasmic dynein with membranous organelles and kinetochores.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000324972
  • ENSP00000320130
  • ENSG00000158560
  • ENST00000359388
  • ENSP00000352348
  • ENST00000437599
  • ENSP00000398118
  • ENST00000447467
  • ENSP00000392337
  • ENST00000457059
  • ENSP00000412444
  • ENST00000630942
  • ENSP00000486363

Symbol
  • DNCI1
  • DNCIC1
  • DNCI1
  • DNCIC1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.84
disease perturbation
0.79
PubMedID
0.69
trait
0.61
molecular function
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.9   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 128   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.9   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 128   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (54)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 33
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Reactome
Amplification of signal from the kinetochores
Reactome
Asparagine N-linked glycosylation
Reactome
COPI-independent Golgi-to-ER retrograde traffic
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Amplification of signal from the kinetochores
Asparagine N-linked glycosylation
COPI-independent Golgi-to-ER retrograde traffic
Gene Ontology Terms (23)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
HGNC
Inferred from Sequence or structural Similarity (ISS)
HGNC
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (352)
1 – 10 of 352
DYNC1LI2
Tbio
Novelty: 0.32608696
p_int: 0.999435532
p_ni: 0.000564468
Score: 0.996
Data Source: BioPlex,Reactome,STRINGDB
WDR34
Tbio
Novelty: 0.09255525
p_int: 0.996383076
p_ni: 0.003616924
Score: 0.755
Data Source: BioPlex,STRINGDB
DYNC1H1
Tbio
Novelty: 0.01357869
p_int: 0.994497295
p_ni: 0.005502705
Score: 0.997
Data Source: BioPlex,Reactome,STRINGDB
DYNC1LI1
Tbio
Novelty: 0.01332297
p_int: 0.993888848
p_ni: 0.006111152
Score: 0.994
Data Source: BioPlex,Reactome,STRINGDB
DISC1
Tbio
Novelty: 0.00165188
p_int: 0.981891551
p_ni: 0.018108449
Score: 0.177
Data Source: BioPlex,STRINGDB
FAM83D
Tbio
Novelty: 0.02089743
p_int: 0.911494364
p_ni: 0.088505622
p_wrong: 1.5e-8
Score: 0.173
Data Source: BioPlex,STRINGDB
DYNC1I2
Tbio
Novelty: 0.00464346
p_int: 0.904373514
p_ni: 0.095626486
Score: 0.987
Data Source: BioPlex,Reactome,STRINGDB
RPL23
Tbio
Novelty: 0.02634055
p_int: 0.878257315
p_ni: 0.121742685
Data Source: BioPlex
C15orf39
Tdark
p_int: 0.867906113
p_ni: 0.132093858
p_wrong: 3e-8
Score: 0.177
Data Source: BioPlex,STRINGDB
SAMD1
Tdark
Novelty: 0.65934066
p_int: 0.867796119
p_ni: 0.131656242
p_wrong: 0.000547638
Data Source: BioPlex
Publication Statistics
PubMed Score  6.90

PubMed score by year
PubTator Score  6.05

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISP
1-70
EPPLVQPLHFLTWDTCYFHYLVPTPMSPSSKSVSTPSEAGSQDSGDLGPLTRTLQWDTDPSVLQLQSDSE
70-140
LGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEEMVESKVGQDSELENQDKKQEVKE
140-210
APPRELTEEEKQQILHSEEFLIFFDRTIRVIERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFNRQFY
210-280
DEHWSKHRVVTCMDWSLQYPELMVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYVFHCQSSVMSVCFAR
280-350
FHPNLVVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGKMCSWSL
350-420
DMLSTPQESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGSKAGIGEVFEGHQGPVTGI
420-490
NCHMAVGPIDFSHLFVTSSFDWTVKLWTTKHNKPLYSFEDNADYVYDVMWSPVHPALFACVDGMGRLDLW
490-560
NLNNDTEVPTASVAIEGASALNRVRWAQAGKEVAVGDSEGRIWVYDVGELAVPHNDEWTRFARTLVEIRA
560-630
NRADSEEEGTVELSA
630-645
MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEADMQQKKEPVQDDSDLDRKRRETEALLQSIGISPEPPLVQPLHFLTWDTCYFHYLVPTPMSPSSKSVSTPSEAGSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEEMVESKVGQDSELENQDKKQEVKEAPPRELTEEEKQQILHSEEFLIFFDRTIRVIERALAEDSDIFFDYSGRELEEKDGDVQAGANLSFNRQFYDEHWSKHRVVTCMDWSLQYPELMVASYNNNEDAPHEPDGVALVWNMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLITVSTDGKMCSWSLDMLSTPQESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGSKAGIGEVFEGHQGPVTGINCHMAVGPIDFSHLFVTSSFDWTVKLWTTKHNKPLYSFEDNADYVYDVMWSPVHPALFACVDGMGRLDLWNLNNDTEVPTASVAIEGASALNRVRWAQAGKEVAVGDSEGRIWVYDVGELAVPHNDEWTRFARTLVEIRANRADSEEEGTVELSA