You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
AQP7
Aquaporin-7

Protein Summary
Description
Forms a channel for water and glycerol. This gene encodes a member of the aquaporin family of water-selective membrane channels. The encoded protein localizes to the plasma membrane and allows movement of water, glycerol and urea across cell membranes. This gene is highly expressed in the adipose tissue where the encoded protein facilitates efflux of glycerol. In the proximal straight tubules of kidney, the encoded protein is localized to the apical membrane and prevents excretion of glycerol into urine. The encoded protein is present in spermatids, as well as in the testicular and epididymal spermatozoa suggesting an important role in late spermatogenesis. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. This gene is located adjacent to a related aquaporin gene on chromosome 9. Multiple pseudogenes of this gene have been identified. [provided by RefSeq, Dec 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000297988
  • ENSP00000297988
  • ENSG00000165269
  • ENST00000447660
  • ENSP00000412868

Symbol
  • AQP7L
  • AQP9
  • AQP7L
  • AQPap
  • GLYCQTL
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
1
disease perturbation
0.68
molecular function
0.67
kinase perturbation
0.6
cell type or tissue
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 184.94   (req: < 5)
Gene RIFs: 24   (req: <= 3)
Antibodies: 122   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 184.94   (req: >= 5)
Gene RIFs: 24   (req: > 3)
Antibodies: 122   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Aquaporin-mediated transport (R-HSA-445717)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Aquaporin-mediated transport
Reactome
Passive transport by Aquaporins
Reactome
Transport of glycerol from adipocytes to the liver by Aquaporins
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
Aquaporin-mediated transport
Passive transport by Aquaporins
Transport of glycerol from adipocytes to the liver by Aquaporins
Transport of small molecules
Gene Ontology Terms (10)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Experiment (EXP)
Reactome
Inferred from Experiment (EXP)
Reactome
Protein-Protein Interactions (20)
1 – 10 of 20
AQP12A
Tbio
Novelty: 0.0840303
Score: 0.865
Data Source: STRINGDB
AQP11
Tbio
Novelty: 0.02650569
Score: 0.827
Data Source: STRINGDB
GK
Tbio
Family: Kinase
Novelty: 0.00835719
Score: 0.681
Data Source: STRINGDB
INS
Tbio
Novelty: 0.00000614
Score: 0.64
Data Source: STRINGDB
LEP
Tbio
Novelty: 0.0000644
Score: 0.582
Data Source: STRINGDB
AQP12B
Tdark
Novelty: 0.75471698
Score: 0.548
Data Source: STRINGDB
PLIN1
Tbio
Novelty: 0.00171066
Score: 0.536
Data Source: STRINGDB
AQP1
Tbio
Novelty: 0.000781
Score: 0.499
Data Source: STRINGDB
AQP8
Tbio
Novelty: 0.00760952
Score: 0.482
Data Source: STRINGDB
KCNJ10
Tbio
Family: IC
Novelty: 0.00337611
Score: 0.477
Data Source: STRINGDB
Publication Statistics
PubMed Score  184.94

PubMed score by year
PubTator Score  66.84

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVQASGHRRSTRGSKMVSWSVIAKIQEILQRKMVREFLAEFMSTYVMMVFGLGSVAHMVLNKKYGSYLGV
1-70
NLGFGFGVTMGVHVAGRISGAHMNAAVTFANCALGRVPWRKFPVYVLGQFLGSFLAAATIYSLFYTAILH
70-140
FSGGQLMVTGPVATAGIFATYLPDHMTLWRGFLNEAWLTGMLQLCLFAITDQENNPALPGTEALVIGILV
140-210
VIIGVSLGMNTGYAINPSRDLPPRIFTFIAGWGKQVFSNGENWWWVPVVAPLLGAYLGGIIYLVFIGSTI
210-280
PREPLKLEDSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMALEHF
280-342
MVQASGHRRSTRGSKMVSWSVIAKIQEILQRKMVREFLAEFMSTYVMMVFGLGSVAHMVLNKKYGSYLGVNLGFGFGVTMGVHVAGRISGAHMNAAVTFANCALGRVPWRKFPVYVLGQFLGSFLAAATIYSLFYTAILHFSGGQLMVTGPVATAGIFATYLPDHMTLWRGFLNEAWLTGMLQLCLFAITDQENNPALPGTEALVIGILVVIIGVSLGMNTGYAINPSRDLPPRIFTFIAGWGKQVFSNGENWWWVPVVAPLLGAYLGGIIYLVFIGSTIPREPLKLEDSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMALEHF