You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
UBE2C
Ubiquitin-conjugating enzyme E2 C

Protein Summary
Description
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of mitotic cyclins and for cell cycle progression, and may be involved in cancer p ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000335046
  • ENSP00000335674
  • ENSG00000175063
  • ENST00000352551
  • ENSP00000333975
  • ENST00000356455
  • ENSP00000348838
  • ENST00000372568
  • ENSP00000361649

Symbol
  • UBCH10
  • UBCH10
  • dJ447F3.2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.97
molecular function
0.96
gene perturbation
0.93
histone modification site profile
0.85
transcription factor perturbation
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 103.53   (req: < 5)
Gene RIFs: 63   (req: <= 3)
Antibodies: 438   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 103.53   (req: >= 5)
Gene RIFs: 63   (req: > 3)
Antibodies: 438   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (46)
APC-Cdc20 mediated degradation of Nek2A (R-HSA-179409)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 41
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
APC-Cdc20 mediated degradation of Nek2A
Reactome
APC/C-mediated degradation of cell cycle proteins
Reactome
APC/C:Cdc20 mediated degradation of Cyclin B
Reactome
APC/C:Cdc20 mediated degradation of Securin
Reactome
APC/C:Cdc20 mediated degradation of mitotic proteins
Name
Explore in Pharos
Explore in Source
APC-Cdc20 mediated degradation of Nek2A
APC/C-mediated degradation of cell cycle proteins
APC/C:Cdc20 mediated degradation of Cyclin B
APC/C:Cdc20 mediated degradation of Securin
APC/C:Cdc20 mediated degradation of mitotic proteins
Protein-Protein Interactions (586)
1 – 10 of 586
PVR
Tbio
Novelty: 0.00031188
p_int: 0.99984296
p_ni: 0.000010905
p_wrong: 0.000146136
Score: 0.195
Data Source: BioPlex,STRINGDB
CDK1
Tchem
Family: Kinase
Novelty: 0.00049984
Score: 0.999
Data Source: STRINGDB
UBE3D
Tbio
Family: Enzyme
Novelty: 0.6122449
Score: 0.999
Data Source: STRINGDB
CDC20
Tbio
Novelty: 0.00237728
Score: 0.999
Data Source: STRINGDB
ANAPC11
Tbio
Family: Enzyme
Novelty: 0.04056134
Score: 0.999
Data Source: STRINGDB
CDC16
Tbio
Novelty: 0.01336597
Score: 0.998
Data Source: STRINGDB
CCNB1
Tchem
Novelty: 0.00068627
Score: 0.998
Data Source: STRINGDB
CCNA2
Tchem
Novelty: 0.00061948
Score: 0.998
Data Source: STRINGDB
AURKA
Tchem
Family: Kinase
Novelty: 0.00069833
Score: 0.998
Data Source: STRINGDB
PTTG1
Tbio
Novelty: 0.00364907
Score: 0.997
Data Source: STRINGDB
Publication Statistics
PubMed Score  103.53

PubMed score by year
PubTator Score  93.75

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAA
1-70
GTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLG
70-140
EPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
140-179
MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP