You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TRIM38
E3 ubiquitin-protein ligase TRIM38

Protein Summary
Description
E3 ubiquitin-protein ligase. Mediates 'Lys-48'-linked polyubiquitination and proteasomal degradation of the critical TLR adapter TICAM1, inhibiting TLR3-mediated type I interferon signaling. This gene encodes a member of the tripartite motif (TRIM) family. The encoded protein contains a RING-type zinc finger, B box-type zinc finger and SPRY domain. The function of this protein has not been identified. A pseudogene of this gene is located on the long arm of chromosome 4. [provided by RefSeq, Jul 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000357085
  • ENSP00000349596
  • ENSG00000112343

Symbol
  • RNF15
  • RORET
  • RNF15
  • RORET
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
1
protein domain
0.99
disease perturbation
0.87
biological process
0.74
gene perturbation
0.7


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.37   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 439   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.37   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 439   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
Interferon Signaling
Reactome
Interferon gamma signaling
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
Interferon Signaling
Interferon gamma signaling
Gene Ontology Terms (13)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (151)
1 – 10 of 151
IRF3
Tbio
Family: TF
Novelty: 0.00132895
Score: 0.934
Data Source: STRINGDB
SP100
Tbio
Family: TF; Epigenetic
Novelty: 0.00264681
Score: 0.932
Data Source: STRINGDB
PML
Tbio
Novelty: 0.0021939
Score: 0.931
Data Source: STRINGDB
IRF7
Tbio
Family: TF
Novelty: 0.00308898
Score: 0.93
Data Source: STRINGDB
OASL
Tbio
Family: Enzyme
Novelty: 0.02020019
Score: 0.924
Data Source: STRINGDB
IRF1
Tbio
Family: TF
Novelty: 0.00077466
Score: 0.919
Data Source: STRINGDB
GBP1
Tbio
Novelty: 0.00826874
Score: 0.916
Data Source: STRINGDB
GBP2
Tbio
Novelty: 0.02823155
Score: 0.914
Data Source: STRINGDB
GBP3
Tbio
Novelty: 0.11267102
Score: 0.913
Data Source: STRINGDB
IRF9
Tbio
Family: TF
Novelty: 0.01154411
Score: 0.913
Data Source: STRINGDB
Publication Statistics
PubMed Score  7.37

PubMed score by year
PubTator Score  7.04

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASTTSTKKMMEEATCSICLSLMTNPVSINCGHSYCHLCITDFFKNPSQKQLRQETFCCPQCRAPFHMDS
1-70
LRPNKQLGSLIEALKETDQEMSCEEHGEQFHLFCEDEGQLICWRCERAPQHKGHTTALVEDVCQGYKEKL
70-140
QKAVTKLKQLEDRCTEQKLSTAMRITKWKEKVQIQRQKIRSDFKNLQCFLHEEEKSYLWRLEKEEQQTLS
140-210
RLRDYEAGLGLKSNELKSHILELEEKCQGSAQKLLQNVNDTLSRSWAVKLETSEAVSLELHTMCNVSKLY
210-280
FDVKKMLRSHQVSVTLDPDTAHHELILSEDRRQVTRGYTQENQDTSSRRFTAFPCVLGCEGFTSGRRYFE
280-350
VDVGEGTGWDLGVCMENVQRGTGMKQEPQSGFWTLRLCKKKGYVALTSPPTSLHLHEQPLLVGIFLDYEA
350-420
GVVSFYNGNTGCHIFTFPKASFSDTLRPYFQVYQYSPLFLPPPGD
420-465
MASTTSTKKMMEEATCSICLSLMTNPVSINCGHSYCHLCITDFFKNPSQKQLRQETFCCPQCRAPFHMDSLRPNKQLGSLIEALKETDQEMSCEEHGEQFHLFCEDEGQLICWRCERAPQHKGHTTALVEDVCQGYKEKLQKAVTKLKQLEDRCTEQKLSTAMRITKWKEKVQIQRQKIRSDFKNLQCFLHEEEKSYLWRLEKEEQQTLSRLRDYEAGLGLKSNELKSHILELEEKCQGSAQKLLQNVNDTLSRSWAVKLETSEAVSLELHTMCNVSKLYFDVKKMLRSHQVSVTLDPDTAHHELILSEDRRQVTRGYTQENQDTSSRRFTAFPCVLGCEGFTSGRRYFEVDVGEGTGWDLGVCMENVQRGTGMKQEPQSGFWTLRLCKKKGYVALTSPPTSLHLHEQPLLVGIFLDYEAGVVSFYNGNTGCHIFTFPKASFSDTLRPYFQVYQYSPLFLPPPGD