You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
DDX3X
ATP-dependent RNA helicase DDX3X

Protein Summary
Description
Multifunctional ATP-dependent RNA helicase. The ATPase activity can be stimulated by various ribo- and deoxynucleic acids indicative for a relaxed substrate specificity. In vitro can unwind partially double-stranded DNA with a preference for 5'-single-stranded DNA overhangs. Is involved in several steps of gene expression, such as transcription, mRNA maturation, mRNA export and translation. However, the exact mechanisms are not known and some functions may be specific for a subset of mRNAs. Involved in transcriptional regulation. Can enhance transcription from the CDKN1A/WAF1 promoter in a SP1-dependent manner. Found associated with the E-cadherin promoter and can down-regulate transcription from the promoter. Involved in regulation of translation initiation. Proposed to be involved in positive regulation of translation such as of cyclin E1/CCNE1 mRNA and specifically of mRNAs containing complex secondary structures in their 5'UTRs; these functions seem to require RNA helicase activity ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000457138
  • ENSP00000392494
  • ENSG00000215301
  • ENST00000478993
  • ENSP00000478443
  • ENST00000629496
  • ENSP00000487224
  • ENST00000629785
  • ENSP00000486516
  • ENST00000630255
  • ENSP00000486720
  • ENST00000644876
  • ENSP00000494040

Symbol
  • DBX
  • DDX3
  • DBX
  • DDX3
  • HLP2
  • DDX14
  • CAP-Rf
  • MRX102
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
hub protein
1
interacting protein
1
molecular function
1
virus perturbation
0.88


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 267.86   (req: < 5)
Gene RIFs: 91   (req: <= 3)
Antibodies: 632   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 267.86   (req: >= 5)
Gene RIFs: 91   (req: > 3)
Antibodies: 632   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 54
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
CHEMBL2011807
chemical structure image
Protein Data Bank (12)
1 – 5 of 12
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (13)
Immune System (R-HSA-168256)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Neutrophil degranulation
Name
Explore in Pharos
Explore in Source
Immune System
Innate Immune System
Neutrophil degranulation
Gene Ontology Terms (64)
Items per page:
10
1 – 10 of 19
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
AgBase
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
AgBase
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
AgBase
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (300)
1 – 10 of 300
CDC5L
Tbio
Family: TF
Novelty: 0.00617757
Score: 0.995
Data Source: STRINGDB
TBK1
Tchem
Family: Kinase
Novelty: 0.00150228
Score: 0.972
Data Source: STRINGDB
EIF4E
Tchem
Novelty: 0.00088513
Score: 0.937
Data Source: STRINGDB
ALYREF
Tbio
Novelty: 0.00114772
Score: 0.928
Data Source: STRINGDB
EIF4G1
Tbio
Novelty: 0.00219215
Score: 0.926
Data Source: STRINGDB
XPO1
Tclin
Novelty: 0.00065429
Score: 0.916
Data Source: STRINGDB
PABPC1
Tbio
Novelty: 0.002455
Score: 0.916
Data Source: STRINGDB
IKBKE
Tchem
Family: Kinase
Novelty: 0.01836892
Score: 0.906
Data Source: STRINGDB
GTPBP4
Tbio
Novelty: 0.00072133
Score: 0.868
Data Source: STRINGDB
USP9X
Tbio
Family: Enzyme
Novelty: 0.00164293
Score: 0.866
Data Source: STRINGDB
Publication Statistics
PubMed Score  267.86

PubMed score by year
PubTator Score  150.55

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYS
1-70
SFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPL
70-140
PPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHA
140-210
IPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAV
210-280
QIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEAD
280-350
RMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVV
350-420
WVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSG
420-490
KSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLL
490-560
VEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGS
560-630
SRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN
630-662
MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN