You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
EXOC5
Exocyst complex component 5

Protein Summary
Description
Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane. The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000621441
  • ENSP00000484855
  • ENSG00000070367

Symbol
  • SEC10
  • SEC10L1
  • SEC10
  • HSEC10
  • SEC10P
  • PRO1912
  • SEC10L1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
1
microRNA
0.95
histone modification site profile
0.87
transcription factor perturbation
0.8
transcription factor binding site profile
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 31.82   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 112   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 31.82   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 112   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (13)
Cargo trafficking to the periciliary membrane (R-HSA-5620920)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cargo trafficking to the periciliary membrane
Reactome
Cilium Assembly
Reactome
Insulin processing
Reactome
Membrane Trafficking
Reactome
Metabolism of proteins
Name
Explore in Pharos
Explore in Source
Cargo trafficking to the periciliary membrane
Cilium Assembly
Insulin processing
Membrane Trafficking
Metabolism of proteins
Gene Ontology Terms (16)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (143)
1 – 10 of 143
EXOC6
Tbio
Novelty: 0.02897817
p_int: 0.999999207
p_ni: 7.93e-7
Score: 0.999
Data Source: BioPlex,STRINGDB
EXOC8
Tbio
Novelty: 0.06047806
p_int: 0.99998659
p_ni: 0.00001341
Score: 0.999
Data Source: BioPlex,STRINGDB
IL1R2
Tbio
Novelty: 0.01061944
p_int: 0.999972316
p_ni: 0.000027684
Score: 0.544
Data Source: BioPlex,STRINGDB
EXOC3
Tbio
Novelty: 0.01423005
p_int: 0.999971275
p_ni: 0.000028725
Score: 0.999
Data Source: BioPlex,STRINGDB
EXOC1
Tbio
Novelty: 0.01279762
p_int: 0.998995729
p_ni: 0.001004271
Score: 0.997
Data Source: BioPlex,STRINGDB
DSN1
Tbio
Novelty: 0.08344924
p_int: 0.998771753
p_ni: 0.001228247
Data Source: BioPlex
DTNBP1
Tbio
Novelty: 0.00371788
p_int: 0.998623589
p_ni: 0.001376411
Score: 0.166
Data Source: BioPlex,STRINGDB
ERP29
Tbio
Novelty: 0.01607061
p_int: 0.99691438
p_ni: 0.003085611
p_wrong: 9e-9
Data Source: BioPlex
STX11
Tbio
Novelty: 0.02724724
p_int: 0.993693549
p_ni: 0.006306451
Score: 0.332
Data Source: BioPlex,STRINGDB
CA14
Tclin
Family: Enzyme
Novelty: 0.0064421
p_int: 0.988444707
p_ni: 0.011555293
Data Source: BioPlex
Publication Statistics
PubMed Score  31.82

PubMed score by year
PubTator Score  21.46

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATTAELFEEPFVADEYIERLVWRTPGGGSRGGPEAFDPKRLLEEFVNHIQELQIMDERIQRKVEKLEQQ
1-70
CQKEAKEFAKKVQELQKSNQVAFQHFQELDEHISYVATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEF
70-140
LDGELKSDVFTNSEKIKEAADIIQKLHLIAQELPFDRFSEVKSKIASKYHDLECQLIQEFTSAQRRGEIS
140-210
RMREVAAVLLHFKGYSHCVDVYIKQCQEGAYLRNDIFEDAGILCQRVNKQVGDIFSNPETVLAKLIQNVF
210-280
EIKLQSFVKEQLEECRKSDAEQYLKNLYDLYTRTTNLSSKLMEFNLGTDKQTFLSKLIKSIFISYLENYI
280-350
EVETGYLKSRSAMILQRYYDSKNHQKRSIGTGGIQDLKERIRQRTNLPLGPSIDTHGETFLSQEVVVNLL
350-420
QETKQAFERCHRLSDPSDLPRNAFRIFTILVEFLCIEHIDYALETGLAGIPSSDSRNANLYFLDVVQQAN
420-490
TIFHLFDKQFNDHLMPLISSSPKLSECLQKKKEIIEQMEMKLDTGIDRTLNCMIGQMKHILAAEQKKTDF
490-560
KPEDENNVLIQYTNACVKVCAYVRKQVEKIKNSMDGKNVDTVLMELGVRFHRLIYEHLQQYSYSCMGGML
560-630
AICDVAEYRKCAKDFKIPMVLHLFDTLHALCNLLVVAPDNLKQVCSGEQLANLDKNILHSFVQLRADYRS
630-700
ARLARHFS
700-708
MATTAELFEEPFVADEYIERLVWRTPGGGSRGGPEAFDPKRLLEEFVNHIQELQIMDERIQRKVEKLEQQCQKEAKEFAKKVQELQKSNQVAFQHFQELDEHISYVATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKIKEAADIIQKLHLIAQELPFDRFSEVKSKIASKYHDLECQLIQEFTSAQRRGEISRMREVAAVLLHFKGYSHCVDVYIKQCQEGAYLRNDIFEDAGILCQRVNKQVGDIFSNPETVLAKLIQNVFEIKLQSFVKEQLEECRKSDAEQYLKNLYDLYTRTTNLSSKLMEFNLGTDKQTFLSKLIKSIFISYLENYIEVETGYLKSRSAMILQRYYDSKNHQKRSIGTGGIQDLKERIRQRTNLPLGPSIDTHGETFLSQEVVVNLLQETKQAFERCHRLSDPSDLPRNAFRIFTILVEFLCIEHIDYALETGLAGIPSSDSRNANLYFLDVVQQANTIFHLFDKQFNDHLMPLISSSPKLSECLQKKKEIIEQMEMKLDTGIDRTLNCMIGQMKHILAAEQKKTDFKPEDENNVLIQYTNACVKVCAYVRKQVEKIKNSMDGKNVDTVLMELGVRFHRLIYEHLQQYSYSCMGGMLAICDVAEYRKCAKDFKIPMVLHLFDTLHALCNLLVVAPDNLKQVCSGEQLANLDKNILHSFVQLRADYRSARLARHFS