You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MEIS1
Homeobox protein Meis1

Protein Summary
Description
Acts as a transcriptional regulator of PAX6. Acts as a transcriptional activator of PF4 in complex with PBX1 or PBX2. Required for hematopoiesis, megakaryocyte lineage development and vascular patterning. May function as a cofactor for HOXA7 and HOXA9 in the induction of myeloid leukemias. Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000272369
  • ENSP00000272369
  • ENSG00000143995
  • ENST00000398506
  • ENSP00000381518
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
1
molecular function
0.9
transcription factor binding site profile
0.86
transcription factor perturbation
0.84
ligand (protein) perturbation
0.83


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 162.57   (req: < 5)
Gene RIFs: 73   (req: <= 3)
Antibodies: 276   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 162.57   (req: >= 5)
Gene RIFs: 73   (req: > 3)
Antibodies: 276   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (8)
Activation of HOX genes during differentiation (R-HSA-5619507)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of HOX genes during differentiation
Reactome
Activation of anterior HOX genes in hindbrain development during early embryogenesis
Reactome
Developmental Biology
Name
Explore in Pharos
Explore in Source
Activation of HOX genes during differentiation
Activation of anterior HOX genes in hindbrain development during early embryogenesis
Developmental Biology
Gene Ontology Terms (17)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (217)
1 – 10 of 217
MAB21L1
Tbio
Novelty: 0.10759186
p_int: 0.999999993
p_ni: 7e-9
Score: 0.896
Data Source: BioPlex,STRINGDB
PBX4
Tbio
Family: TF
Novelty: 0.10934825
p_int: 0.999999983
p_ni: 1.8e-8
Score: 0.405
Data Source: BioPlex,STRINGDB
MAB21L2
Tbio
Novelty: 0.05944378
p_int: 0.999999868
p_ni: 1.32e-7
Score: 0.808
Data Source: BioPlex,STRINGDB
MEIS2
Tbio
Family: TF
Novelty: 0.01900867
p_int: 0.999999839
p_ni: 1.62e-7
Score: 0.994
Data Source: BioPlex,STRINGDB
LMX1B
Tbio
Family: TF
Novelty: 0.00535467
p_int: 0.999999661
p_ni: 3.39e-7
Score: 0.898
Data Source: BioPlex,STRINGDB
FAM222A
Tdark
p_int: 0.999995462
p_ni: 0.000004538
Score: 0.825
Data Source: BioPlex,STRINGDB
C16orf71
Tdark
p_int: 0.999843546
p_ni: 0.000156454
Score: 0.313
Data Source: BioPlex,STRINGDB
CCDC120
Tbio
Novelty: 0.71428571
p_int: 0.999555589
p_ni: 0.00044441
p_wrong: 1e-9
Data Source: BioPlex
C5orf24
Tdark
Novelty: 10
p_int: 0.999255302
p_ni: 0.000744698
Score: 0.191
Data Source: BioPlex,STRINGDB
COL20A1
Tdark
Novelty: 1.49268293
p_int: 0.946306196
p_ni: 0.052640099
p_wrong: 0.001053705
Score: 0.202
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  162.57

PubMed score by year
PubTator Score  118.23

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDA
1-70
LKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPE
70-140
LDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQ
140-210
PSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFP
210-280
KVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNP
280-350
DGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM
350-390
MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM