You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GOLIM4
Golgi integral membrane protein 4

Protein Summary
Description
Plays a role in endosome to Golgi protein trafficking; mediates protein transport along the late endosome-bypass pathway from the early endosome to the Golgi. The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000470487
  • ENSP00000417354
  • ENSG00000173905

Symbol
  • GIMPC
  • GOLPH4
  • GPP130
  • P138
  • GIMPC
  • GOLPH4
  • GPP130
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.94
interacting protein
0.85
transcription factor perturbation
0.84
ligand (protein) perturbation
0.83
cellular component
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 33.61   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 116   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 33.61   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 116   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Intra-Golgi and retrograde Golgi-to-ER traffic (R-HSA-6811442)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Intra-Golgi and retrograde Golgi-to-ER traffic
Reactome
Intra-Golgi traffic
Reactome
Membrane Trafficking
Reactome
Vesicle-mediated transport
Name
Explore in Pharos
Explore in Source
Intra-Golgi and retrograde Golgi-to-ER traffic
Intra-Golgi traffic
Membrane Trafficking
Vesicle-mediated transport
Gene Ontology Terms (10)
Items per page:
10
1 – 10 of 10
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
HPA
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (92)
1 – 10 of 92
CSTL1
Tdark
Novelty: 0.27027027
p_int: 0.999972293
p_ni: 0.000027706
p_wrong: 1e-9
Data Source: BioPlex
SYNE4
Tdark
Novelty: 0.21538462
p_int: 0.999964397
p_ni: 0.000035594
p_wrong: 9e-9
Data Source: BioPlex
B3GAT3
Tbio
Family: Enzyme
Novelty: 0.03234252
p_int: 0.999943938
p_ni: 0.000056032
p_wrong: 3e-8
Score: 0.546
Data Source: BioPlex,STRINGDB
TRDN
Tbio
Novelty: 0.00251509
p_int: 0.999924966
p_ni: 0.000075033
p_wrong: 1e-9
Data Source: BioPlex
PRTN3
Tchem
Family: Enzyme
Novelty: 0.00031566
p_int: 0.999747494
p_ni: 0.000252505
p_wrong: 1e-9
Data Source: BioPlex
DCAF12
Tbio
Novelty: 0.09567198
p_int: 0.999689603
p_ni: 0.000310391
p_wrong: 6e-9
Data Source: BioPlex
PTPRU
Tbio
Family: Enzyme
Novelty: 0.00322355
p_int: 0.999180459
p_ni: 0.00081954
p_wrong: 1e-9
Data Source: BioPlex
CD79B
Tclin
Novelty: 0.00265318
p_int: 0.998896029
p_ni: 0.001101825
p_wrong: 0.000002145
Data Source: BioPlex
ATP2B2
Tbio
Family: Transporter
Novelty: 0.00724828
p_int: 0.998671663
p_ni: 0.001328337
Data Source: BioPlex
HLA-DPA1
Tbio
Novelty: 0.01432663
p_int: 0.997006949
p_ni: 0.002993051
Data Source: BioPlex
Publication Statistics
PubMed Score  33.61

PubMed score by year
PubTator Score  22.04

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYYELQTQLRKAEAVALKYQQHQESLSAQLQVVYEHRSR
1-70
LEKSLQKERLEHKKAKEDFLVYKLEAQETLNKGRQDSNSRYSALNVQHQMLKSQHEELKKQHSDLEEEHR
70-140
KQGEDFSRTFNDHKQKYLQLQQEKEQELSKLKETVYNLREENRQLRKAHQDIHTQLQDVKQQHKNLLSEH
140-210
EQLVVTLEDHKSALAAAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQ
210-280
EVSRNNDVWQNHEAVPGRAEDTKLYAPTHKEAEFQAPPEPIQQEVERREPEEHQVEEEHRKALEEEEMEQ
280-350
VGQAEHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQ
350-420
VEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDI
420-490
VQGAEDQGIQGEEGAYERDNQHQDEAEGDPGNRHEPREQGPREADPESEADRAAVEDINPADDPNNQGED
490-560
EFEEAEQVREENLPDENEEQKQSNQKQENTEVEEHLVMAGNPDQQEDNVDEQYQEEAEEEVQEDLTEEKK
560-630
RELEHNAEETYGENDENTDDKNNDGEEQEVRDDNRPKGREEHYEEEEEEEEDGAAVAEKSHRRAEM
630-696
MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYYELQTQLRKAEAVALKYQQHQESLSAQLQVVYEHRSRLEKSLQKERLEHKKAKEDFLVYKLEAQETLNKGRQDSNSRYSALNVQHQMLKSQHEELKKQHSDLEEEHRKQGEDFSRTFNDHKQKYLQLQQEKEQELSKLKETVYNLREENRQLRKAHQDIHTQLQDVKQQHKNLLSEHEQLVVTLEDHKSALAAAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQEVSRNNDVWQNHEAVPGRAEDTKLYAPTHKEAEFQAPPEPIQQEVERREPEEHQVEEEHRKALEEEEMEQVGQAEHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGAEDQGIQGEEGAYERDNQHQDEAEGDPGNRHEPREQGPREADPESEADRAAVEDINPADDPNNQGEDEFEEAEQVREENLPDENEEQKQSNQKQENTEVEEHLVMAGNPDQQEDNVDEQYQEEAEEEVQEDLTEEKKRELEHNAEETYGENDENTDDKNNDGEEQEVRDDNRPKGREEHYEEEEEEEEDGAAVAEKSHRRAEM