You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PIK3R2
Phosphatidylinositol 3-kinase regulatory subunit beta

Protein Summary
Description
Regulatory subunit of phosphoinositide-3-kinase (PI3K), a kinase that phosphorylates PtdIns(4,5)P2 (Phosphatidylinositol 4,5-bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Binds to activated (phosphorylated) protein-tyrosine kinases, through its SH2 domain, and acts as an adapter, mediating the association of the p110 catalytic unit to the plasma membrane. Indirectly regulates autophagy (PubMed:23604317). Promotes nuclear translocation of XBP1 isoform 2 in a ER stress- and/or insulin-dependent manner during metabolic overloading in the liver and hence plays a role in glucose tolerance improvement (By similarity). Phosphatidylinositol 3-kinase (PI3K) is a lipid kinase that phosphorylates phosphatidylinositol and similar compounds, creating second me ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000222254
  • ENSP00000222254
  • ENSG00000105647
  • ENST00000617130
  • ENSP00000477864

Symbol
  • p85
  • MPPH
  • P85B
  • MPPH1
  • p85-BETA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.99
hub protein
0.98
interacting protein
0.97
pathway
0.91
transcription factor binding site profile
0.89


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 81.9   (req: < 5)
Gene RIFs: 40   (req: <= 3)
Antibodies: 571   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 81.9   (req: >= 5)
Gene RIFs: 40   (req: > 3)
Antibodies: 571   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 28
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (259)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 71
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Axon guidance
Reactome
CD28 co-stimulation
Reactome
CD28 dependent PI3K/Akt signaling
Reactome
Cell surface interactions at the vascular wall
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Axon guidance
CD28 co-stimulation
CD28 dependent PI3K/Akt signaling
Cell surface interactions at the vascular wall
Gene Ontology Terms (31)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
ParkinsonsUK-UCL
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Protein-Protein Interactions (472)
1 – 10 of 472
HAUS4
Tbio
Novelty: 7
p_int: 0.999199404
p_ni: 0.000800596
Data Source: BioPlex
RCBTB2
Tbio
Novelty: 0.02765308
p_int: 0.997078248
p_ni: 0.002921749
p_wrong: 3e-9
Score: 0.219
Data Source: BioPlex,STRINGDB
PIK3R3
Tbio
Family: Enzyme
Novelty: 0.02218437
p_int: 0.990984064
p_ni: 0.009015936
Score: 0.982
Data Source: BioPlex,STRINGDB
HAUS1
Tbio
Novelty: 0.04680423
p_int: 0.974402783
p_ni: 0.025597032
p_wrong: 1.85e-7
Score: 0.204
Data Source: BioPlex,STRINGDB
PIK3R1
Tchem
Family: Kinase
Novelty: 0.00286014
p_int: 0.965590096
p_ni: 0.034409904
Score: 0.983
Data Source: BioPlex,STRINGDB
HAVCR2
Tbio
Novelty: 0.00217571
p_int: 0.95223554
p_ni: 0.04776446
Data Source: BioPlex
PTGER3
Tclin
Family: GPCR
Novelty: 0.00155764
p_int: 0.903752732
p_ni: 0.096247268
Data Source: BioPlex
PIK3CB
Tchem
Family: Kinase
Novelty: 0.00458119
p_int: 0.85797798
p_ni: 0.141833801
p_wrong: 0.00018822
Score: 0.998
Data Source: BioPlex,Reactome,STRINGDB
TMEM52B
Tdark
Novelty: 1
p_int: 0.850635684
p_ni: 0.149364316
Score: 0.303
Data Source: BioPlex,STRINGDB
RNF19B
Tbio
Family: Enzyme
Novelty: 0.17995417
p_int: 0.844517743
p_ni: 0.155482257
Score: 0.195
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  81.90

PubMed score by year
PubTator Score  373.97

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGLNERTRQRGDF
1-70
PGTYVEFLGPVALARPGPRPRGPRPLPARPRDGAPEPGLTLPDLPEQFSPPDVAPPLLVKLVEAIERTGL
70-140
DSESHYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLALPAPLVTPEASAEARRALREAAGPVGPALE
140-210
PPTLPLHRALTLRFLLQHLGRVASRAPALGPAVRALGATFGPLLLRAPPPPSSPPPGGAPDGSEPSPDFP
210-280
ALLVEKLLQEHLEEQEVAPPALPPKPPKAKPASTVLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDG
280-350
TFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHYRHESLAQYNAKLDTR
350-420
LLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKI
420-490
FEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQQLRAQASDNREIDKRM
490-560
NSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQYALMEDEDDLPHHEERTWYVGKINRT
560-630
QAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHAS
630-700
LVQHNDALTVTLAHPVRAPGPGPPPAAR
700-728
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGLNERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGAPEPGLTLPDLPEQFSPPDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLALPAPLVTPEASAEARRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRVASRAPALGPAVRALGATFGPLLLRAPPPPSSPPPGGAPDGSEPSPDFPALLVEKLLQEHLEEQEVAPPALPPKPPKAKPASTVLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHYRHESLAQYNAKLDTRLLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQQLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPPPAAR