You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IFRD1
Interferon-related developmental regulator 1

Protein Summary
Description
Could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. May be an autocrine factor that attenuates or amplifies the initial ligand-induced signal (By similarity). This gene is an immediate early gene that encodes a protein related to interferon-gamma. This protein may function as a transcriptional co-activator/repressor that controls the growth and differentiation of specific cell types during embryonic development and tissue regeneration. Mutations in this gene are associated with sensory/motor neuropathy with ataxia. This gene may also be involved in modulating the pathogenesis of cystic fibrosis lung disease. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000005558
  • ENSP00000005558
  • ENSG00000006652
  • ENST00000403825
  • ENSP00000384477
  • ENST00000535603
  • ENSP00000439188
  • ENST00000621379
  • ENSP00000483255

Symbol
  • PC4
  • TIS7
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.97
co-expressed gene
0.95
PubMedID
0.85
transcription factor
0.81
small molecule perturbation
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 37.09   (req: < 5)
Gene RIFs: 27   (req: <= 3)
Antibodies: 156   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 37.09   (req: >= 5)
Gene RIFs: 27   (req: > 3)
Antibodies: 156   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (21)
Items per page:
1 – 5 of 21
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
Hypertrophy Model
WikiPathways
Hypertrophy Model
WikiPathways
Hypertrophy Model
WikiPathways
Hypertrophy Model
WikiPathways
Hypertrophy Model
Name
Explore in Pharos
Explore in Source
Hypertrophy Model
Hypertrophy Model
Hypertrophy Model
Hypertrophy Model
Hypertrophy Model
Gene Ontology Terms (8)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (42)
1 – 10 of 42
COMTD1
Tdark
Family: Enzyme
Novelty: 0.34090909
p_int: 0.99999912
p_ni: 8.8e-7
Score: 0.207
Data Source: BioPlex,STRINGDB
CD70
Tbio
Novelty: 0.00552433
p_int: 0.969438946
p_ni: 0.000039068
p_wrong: 0.030521986
Score: 0.177
Data Source: BioPlex,STRINGDB
TRAFD1
Tdark
Novelty: 0.30821918
Score: 0.67
Data Source: STRINGDB
SIN3B
Tbio
Novelty: 0.04173216
Score: 0.648
Data Source: STRINGDB
HDAC1
Tclin
Family: Epigenetic
Novelty: 0.00083441
Score: 0.642
Data Source: STRINGDB
ANKMY2
Tdark
Novelty: 1.16129032
Score: 0.621
Data Source: STRINGDB
MYOD1
Tbio
Family: TF
Novelty: 0.00064991
Score: 0.576
Data Source: STRINGDB
DDX24
Tbio
Family: Enzyme
Novelty: 0.24108488
Score: 0.56
Data Source: STRINGDB
SAP30
Tbio
Family: Enzyme
Novelty: 0.05788749
Score: 0.557
Data Source: STRINGDB
MEF2C
Tbio
Family: TF
Novelty: 0.00288254
Score: 0.544
Data Source: STRINGDB
Publication Statistics
PubMed Score  37.09

PubMed score by year
PubTator Score  20.09

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPKNKKRNTPHRGSSAGGGGSGAAAATAATAGGQHRNVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEV
1-70
LDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGIKNALASKMLYEFILERRMTLTDSIERCLKKGKSD
70-140
EQRAAAALASVLCIQLGPGIESEEILKTLGPILKKIICDGSASMQARQTCATCFGVCCFIATDDITELYS
140-210
TLECLENIFTKSYLKEKDTTVICSTPNTVLHISSLLAWTLLLTICPINEVKKKLEMHFHKLPSLLSCDDV
210-280
NMRIAAGESLALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVFRDVLRAVEERD
280-350
FPTETIKFGPERMYIDCWVKKHTYDTFKEVLGSGMQYHLQSNEFLRNVFELGPPVMLDAATLKTMKISRF
350-420
ERHLYNSAAFKARTKARSKCRDKRADVGEFF
420-451
MPKNKKRNTPHRGSSAGGGGSGAAAATAATAGGQHRNVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGIKNALASKMLYEFILERRMTLTDSIERCLKKGKSDEQRAAAALASVLCIQLGPGIESEEILKTLGPILKKIICDGSASMQARQTCATCFGVCCFIATDDITELYSTLECLENIFTKSYLKEKDTTVICSTPNTVLHISSLLAWTLLLTICPINEVKKKLEMHFHKLPSLLSCDDVNMRIAAGESLALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVFRDVLRAVEERDFPTETIKFGPERMYIDCWVKKHTYDTFKEVLGSGMQYHLQSNEFLRNVFELGPPVMLDAATLKTMKISRFERHLYNSAAFKARTKARSKCRDKRADVGEFF