You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SUPT5H
Transcription elongation factor SPT5

Protein Summary
Description
Component of the DRB sensitivity-inducing factor complex (DSIF complex), which regulates mRNA processing and transcription elongation by RNA polymerase II. DSIF positively regulates mRNA capping by stimulating the mRNA guanylyltransferase activity of RNGTT/CAP1A. DSIF also acts cooperatively with the negative elongation factor complex (NELF complex) to enhance transcriptional pausing at sites proximal to the promoter. Transcriptional pausing may facilitate the assembly of an elongation competent RNA polymerase II complex. DSIF and NELF promote pausing by inhibition of the transcription elongation factor TFIIS/S-II. TFIIS/S-II binds to RNA polymerase II at transcription pause sites and stimulates the weak intrinsic nuclease activity of the enzyme. Cleavage of blocked transcripts by RNA polymerase II promotes the resumption of transcription from the new 3' terminus and may allow repeated attempts at transcription through natural pause sites. DSIF can also positively regulate transcriptio ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000359191
  • ENSP00000352117
  • ENSG00000196235
  • ENST00000402194
  • ENSP00000384505
  • ENST00000432763
  • ENSP00000404029
  • ENST00000598725
  • ENSP00000469090
  • ENST00000599117
  • ENSP00000470252

Symbol
  • SPT5
  • SPT5H
  • SPT5
  • SPT5H
  • Tat-CT1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
hub protein
0.98
interacting protein
0.93
biological process
0.92
protein domain
0.92
kinase perturbation
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 101.06   (req: < 5)
Gene RIFs: 20   (req: <= 3)
Antibodies: 170   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 101.06   (req: >= 5)
Gene RIFs: 20   (req: > 3)
Antibodies: 170   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (12)
1 – 5 of 12
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (32)
Abortive elongation of HIV-1 transcript in the absence of Tat (R-HSA-167242)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 30
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Abortive elongation of HIV-1 transcript in the absence of Tat
Reactome
Disease
Reactome
Formation of HIV elongation complex in the absence of HIV Tat
Reactome
Formation of HIV-1 elongation complex containing HIV-1 Tat
Reactome
Formation of RNA Pol II elongation complex
Name
Explore in Pharos
Explore in Source
Abortive elongation of HIV-1 transcript in the absence of Tat
Disease
Formation of HIV elongation complex in the absence of HIV Tat
Formation of HIV-1 elongation complex containing HIV-1 Tat
Formation of RNA Pol II elongation complex
Gene Ontology Terms (17)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (304)
1 – 10 of 304
PAK5
Tchem
Family: Kinase
Novelty: 0.0259775
p_int: 0.99327817
p_ni: 0.00672183
Score: 0.16
Data Source: BioPlex,STRINGDB
PLEKHJ1
Tdark
Novelty: 4
p_int: 0.983996562
p_ni: 0.016003438
Data Source: BioPlex
KHDRBS2
Tbio
Novelty: 0.04072144
p_int: 0.9822403
p_ni: 0.0177597
Score: 0.213
Data Source: BioPlex,STRINGDB
FGF12
Tbio
Novelty: 0.03928258
p_int: 0.977973863
p_ni: 0.022026137
Data Source: BioPlex
DOK4
Tbio
Novelty: 0.06540971
p_int: 0.97133852
p_ni: 0.02866148
Score: 0.181
Data Source: BioPlex,STRINGDB
STRIP2
Tbio
Novelty: 0.15494343
p_int: 0.966205774
p_ni: 0.033794226
Data Source: BioPlex
PLCD4
Tbio
Family: Enzyme
Novelty: 0.06740018
p_int: 0.931356991
p_ni: 0.068643009
Data Source: BioPlex
CPNE4
Tbio
Novelty: 0.16761129
p_int: 0.901806885
p_ni: 0.098193115
Data Source: BioPlex
CPNE2
Tdark
Novelty: 0.33799663
p_int: 0.879343157
p_ni: 0.120656843
Data Source: BioPlex
PLEKHO1
Tbio
Novelty: 0.01414157
p_int: 0.835142947
p_ni: 0.164857053
Data Source: BioPlex
Publication Statistics
PubMed Score  101.06

PubMed score by year
PubTator Score  52.77

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSDSEDSNFSEEEDSERSSDGEEAEVDEERRSAAGSEKEEEPEDEEEEEEEEEYDEEEEEEDDDRPPKKP
1-70
RHGGFILDEADVDDEYEDEDQWEDGAEDILEKEEIEASNIDNVVLDEDRSGARRLQNLWRDQREEELGEY
70-140
YMKKYAKSSVGETVYGGSDELSDDITQQQLLPGVKDPNLWTVKCKIGEERATAISLMRKFIAYQFTDTPL
140-210
QIKSVVAPEHVKGYIYVEAYKQTHVKQAIEGVGNLRLGYWNQQMVPIKEMTDVLKVVKEVANLKPKSWVR
210-280
LKRGIYKDDIAQVDYVEPSQNTISLKMIPRIDYDRIKARMSLKDWFAKRKKFKRPPQRLFDAEKIRSLGG
280-350
DVASDGDFLIFEGNRYSRKGFLFKSFAMSAVITEGVKPTLSELEKFEDQPEGIDLEVVTESTGKEREHNF
350-420
QPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKYFKMGDHVKVIAGRFEGDTG
420-490
LIVRVEENFVILFSDLTMHELKVLPRDLQLCSETASGVDVGGQHEWGELVQLDPQTVGVIVRLERETFQV
490-560
LNMYGKVVTVRHQAVTRKKDNRFAVALDSEQNNIHVKDIVKVIDGPHSGREGEIRHLFRSFAFLHCKKLV
560-630
ENGGMFVCKTRHLVLAGGSKPRDVTNFTVGGFAPMSPRISSPMHPSAGGQRGGFGSPGGGSGGMSRGRGR
630-700
RDNELIGQTVRISQGPYKGYIGVVKDATESTARVELHSTCQTISVDRQRLTTVGSRRPGGMTSTYGRTPM
700-770
YGSQTPMYGSGSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAF
770-840
DDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQS
840-910
YHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWV
910-980
TTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDRE
980-1050
ATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA
1050-1087
MSDSEDSNFSEEEDSERSSDGEEAEVDEERRSAAGSEKEEEPEDEEEEEEEEEYDEEEEEEDDDRPPKKPRHGGFILDEADVDDEYEDEDQWEDGAEDILEKEEIEASNIDNVVLDEDRSGARRLQNLWRDQREEELGEYYMKKYAKSSVGETVYGGSDELSDDITQQQLLPGVKDPNLWTVKCKIGEERATAISLMRKFIAYQFTDTPLQIKSVVAPEHVKGYIYVEAYKQTHVKQAIEGVGNLRLGYWNQQMVPIKEMTDVLKVVKEVANLKPKSWVRLKRGIYKDDIAQVDYVEPSQNTISLKMIPRIDYDRIKARMSLKDWFAKRKKFKRPPQRLFDAEKIRSLGGDVASDGDFLIFEGNRYSRKGFLFKSFAMSAVITEGVKPTLSELEKFEDQPEGIDLEVVTESTGKEREHNFQPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKYFKMGDHVKVIAGRFEGDTGLIVRVEENFVILFSDLTMHELKVLPRDLQLCSETASGVDVGGQHEWGELVQLDPQTVGVIVRLERETFQVLNMYGKVVTVRHQAVTRKKDNRFAVALDSEQNNIHVKDIVKVIDGPHSGREGEIRHLFRSFAFLHCKKLVENGGMFVCKTRHLVLAGGSKPRDVTNFTVGGFAPMSPRISSPMHPSAGGQRGGFGSPGGGSGGMSRGRGRRDNELIGQTVRISQGPYKGYIGVVKDATESTARVELHSTCQTISVDRQRLTTVGSRRPGGMTSTYGRTPMYGSQTPMYGSGSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA