You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
WRB
Tail-anchored protein insertion receptor WRB

Protein Summary
Description
Receptor for ASNA1/TRC40-mediated insertion of tail-anchored (TA) proteins into the ER membrane. This gene is located in the candidate region for congenital heart disease (CHD) in Down syndrome (DS). It encodes a basic protein that functions as a receptor that promotes insertion of tail-anchored proteins in the endoplasmic reticulum membrane. This gene is located at a maternally-methylated differentially methylated region (DMR); however, its transcription may be biallelic, not imprinted. Alternative splicing results in different transcript variants. A pseudogene has been defined on chromosome 4. [provided by RefSeq, Apr 2017]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000333781
  • ENSP00000327716
  • ENSG00000182093
  • ENST00000380708
  • ENSP00000370084
  • ENST00000398753
  • ENSP00000381737
  • ENST00000649170
  • ENSP00000496813
  • ENST00000650376
  • ENSP00000497103

Symbol
  • CHD5
  • CHD5
  • GET1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.88
histone modification site profile
0.76
disease perturbation
0.74
tissue sample
0.72
virus perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 104.42   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 131   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 104.42   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 131   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (2)
Insertion of tail-anchored proteins into the endoplasmic reticulum membrane (R-HSA-9609523)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Insertion of tail-anchored proteins into the endoplasmic reticulum membrane
Reactome
Protein localization
Name
Explore in Pharos
Explore in Source
Insertion of tail-anchored proteins into the endoplasmic reticulum membrane
Protein localization
Gene Ontology Terms (4)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (87)
1 – 10 of 87
ASNA1
Tbio
Family: Enzyme
Novelty: 0.0127531
p_int: 0.999498812
p_ni: 0.000501188
Score: 0.995
Data Source: BioPlex,Reactome,STRINGDB
MCOLN3
Tchem
Family: IC
Novelty: 0.05172316
p_int: 0.961954509
p_ni: 0.038045422
p_wrong: 7e-8
Data Source: BioPlex
SLC39A12
Tbio
Family: Transporter
Novelty: 0.11255353
p_int: 0.905364207
p_ni: 0.0946352
p_wrong: 5.92e-7
Data Source: BioPlex
LRRC55
Tbio
Family: IC
Novelty: 0.37735849
p_int: 0.864592532
p_ni: 0.135407468
Data Source: BioPlex
ITGB8
Tbio
Novelty: 0.02328147
p_int: 0.858312923
p_ni: 0.141582575
p_wrong: 0.000104502
Score: 0.314
Data Source: BioPlex,STRINGDB
ERGIC3
Tbio
Novelty: 0.15783642
p_int: 0.814310328
p_ni: 0.185647052
p_wrong: 0.00004262
Score: 0.161
Data Source: BioPlex,STRINGDB
CMTM8
Tbio
Novelty: 0.13251301
p_int: 0.804905351
p_ni: 0.195093236
p_wrong: 0.000001414
Data Source: BioPlex
SLC22A9
Tbio
Family: Transporter
Novelty: 0.02803169
p_int: 0.801673689
p_ni: 0.198325667
p_wrong: 6.44e-7
Data Source: BioPlex
TLR1
Tbio
Novelty: 0.00100796
p_int: 0.796880934
p_ni: 0.202619806
p_wrong: 0.00049926
Data Source: BioPlex
CAMLG
Tbio
Novelty: 0.01056088
Score: 0.909
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  104.42

PubMed score by year
PubTator Score  79.17

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSSAAADHWAWLLVLSFVFGCNVLRILLPSFSSFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFA
1-70
RYARLERKINKMTDKLKTHVKARTAQLAKIKWVISVAFYVLQAALMISLIWKYYSVPVAVVPSKWITPLD
70-140
RLVAFPTRVAGGVGITCWILVCNKVVAIVLHPFS
140-174
MSSAAADHWAWLLVLSFVFGCNVLRILLPSFSSFMSRVLQKDAEQESQMRAEIQDMKQELSTVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIKWVISVAFYVLQAALMISLIWKYYSVPVAVVPSKWITPLDRLVAFPTRVAGGVGITCWILVCNKVVAIVLHPFS