You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NPTN
Neuroplastin

Protein Summary
Description
Probable homophilic and heterophilic cell adhesion molecule involved in long term potentiation at hippocampal excitatory synapses through activation of p38MAPK. May also regulate neurite outgrowth by activating the FGFR1 signaling pathway. May play a role in synaptic plasticity (By similarity). This gene encodes a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000345330
  • ENSP00000290401
  • ENSG00000156642
  • ENST00000351217
  • ENSP00000342958
  • ENST00000562924
  • ENSP00000456349
  • ENST00000563691
  • ENSP00000457028

Symbol
  • SDFR1
  • SDR1
  • GP55
  • GP65
  • SDR1
  • np55
  • np65
  • SDFR1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.99
transcription factor perturbation
0.91
protein domain
0.85
biological process
0.79
transcription factor binding site profile
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 218.85   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 294   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 218.85   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 294   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
GABA receptor activation (R-HSA-977443)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
GABA receptor activation
Reactome
Neuronal System
Reactome
Neurotransmitter receptors and postsynaptic signal transmission
Reactome
Transmission across Chemical Synapses
Name
Explore in Pharos
Explore in Source
GABA receptor activation
Neuronal System
Neurotransmitter receptors and postsynaptic signal transmission
Transmission across Chemical Synapses
Protein-Protein Interactions (53)
1 – 10 of 53
GABRG2
Tclin
Family: IC
Novelty: 0.01062612
Score: 0.927
Data Source: Reactome,STRINGDB
GABRA1
Tclin
Family: IC
Novelty: 0.01400071
Score: 0.919
Data Source: STRINGDB
GABRB2
Tclin
Family: IC
Novelty: 0.02660189
Score: 0.917
Data Source: Reactome,STRINGDB
GABRA4
Tclin
Family: IC
Novelty: 0.04887612
Score: 0.914
Data Source: STRINGDB
GABRB1
Tclin
Family: IC
Novelty: 0.04413659
Score: 0.909
Data Source: Reactome,STRINGDB
GABRA2
Tclin
Family: IC
Novelty: 0.01043049
Score: 0.907
Data Source: STRINGDB
GABRA5
Tclin
Family: IC
Novelty: 0.02498565
Score: 0.907
Data Source: STRINGDB
ARHGEF9
Tbio
Novelty: 0.0288079
Score: 0.905
Data Source: STRINGDB
GABRB3
Tclin
Family: IC
Novelty: 0.00713058
Score: 0.904
Data Source: Reactome,STRINGDB
GABRA6
Tclin
Family: IC
Novelty: 0.03834602
Score: 0.902
Data Source: STRINGDB
Publication Statistics
PubMed Score  218.85

PubMed score by year
PubTator Score  82.39

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSGSSLPSALALSLLLVSGSLLPGPGAAQNAGFVKSPMSETKLTGDAFELYCDVVGSPTPEIQWWYAEVN
1-70
RAESFRQLWDGARKRRVTVNTAYGSNGVSVLRITRLTLEDSGTYECRASNDPKRNDLRQNPSITWIRAQA
70-140
TISVLQKPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTKNGVELSATRKNASNMEYRINKPRA
140-210
EDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRKKENGMPM
210-280
DIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHLAPLWPFLGILAEI
280-350
IILVVIIVVYEKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRNTN
350-398
MSGSSLPSALALSLLLVSGSLLPGPGAAQNAGFVKSPMSETKLTGDAFELYCDVVGSPTPEIQWWYAEVNRAESFRQLWDGARKRRVTVNTAYGSNGVSVLRITRLTLEDSGTYECRASNDPKRNDLRQNPSITWIRAQATISVLQKPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTKNGVELSATRKNASNMEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRKKENGMPMDIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRNTN